Details for Kale Locus Bo5g126660

Position : C5 ( 5`- 39012965 .. 39013449 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126660

Protein [Map View]
MSSMLGCSGGTVAIATAMVFSSTALFLAMARQFHGKIHDQTPPPILRSCLSSEETKKQRKKKRVRFAGNVKDTKGNGKEY
RKRELSRRTVPEPVTKPGKTGSVCGISTMPANRMALYHGILRDRDHRTQCSY*

DNA
ATGTCTTCCATGTTGGGTTGTTCTGGTGGCACCGTAGCGATCGCAACCGCCATGGTTTTCTCGAGCACTGCTCTGTTTCT
CGCGATGGCTCGACAGTTCCATGGGAAGATTCATGATCAAACTCCACCACCGATACTCCGTTCATGTCTATCTTCAGAGG
AAACGAAGAAACAGAGGAAGAAGAAGAGAGTTCGCTTCGCGGGGAATGTGAAAGATACGAAAGGGAACGGGAAAGAGTAC
CGGAAGAGGGAATTGAGCAGGAGAACCGTACCGGAGCCAGTGACTAAACCGGGTAAGACCGGTTCAGTTTGTGGAATATC
AACGATGCCAGCGAACCGGATGGCTCTGTATCACGGGATTCTCAGAGACCGAGATCACAGAACTCAATGTTCTTATTGA