Details for Kale Locus Bo5g126640

Position : C5 ( 5`- 39000888 .. 39008886 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126640

Protein [Map View]
DKQAEPTTNNIPKFFSRLAFISVVTIFFFSDESNPPPRLSLCEIVKSFFLVAFFFLNFLLPLFLRDCNNNKMGTEDEIVS
VELPAPSSWKKLESAVVSPSRRYSSTVSAAEPLSLTAFGLSYLSRRRILFSRHCINPSFVDSIRYHGSTAKDDAAPFVSV
YRLLIDNLIKAKRLEMALTLLEESATLVSYGSTYNMFAFRLFSEMTKKGVSPDMQTFCSLVKGLFRDRKISEALLLPDFV
SHMLDGASDAEHPTQNLKLPRLGASDNVLGRSPRACGGIGFLGPKSLETASMLHKAEKTVDIEEVGVIHRSFNNHPVPGT
LSGNEPAEALIRRKVWTKWSEDNNFYEAVITQYSAVEFFPNKAKKTEIVFVSPTGEEFSNRKQLEQYLKSHPGSPAIAEF
DWTTNKEPLKKRGRTKSSGSKKDTDEGEKPEGGVENSNVQEEDSEMTHPKENENLNVKDSFGEIEKADDMVSEEKDNVRS
RSYSIALHCPASVSLSNYYLEDT*

DNA
GACAAACAAGCAGAGCCTACAACTAACAACATCCCTAAATTTTTCAGCCGTCTTGCTTTCATCTCCGTGGTAACTATTTT
TTTTTTTTCTGACGAATCGAACCCTCCTCCTAGGTTATCTCTTTGTGAAATTGTTAAATCTTTTTTTTTGGTGGCATTTT
TTTTTCTGAATTTTCTTTTGCCTCTGTTTTTAAGGGATTGCAACAACAACAAAATGGGTACAGAAGATGAAATTGTATCT
GTGGAGCTACCAGCACCTTCTTCATGGAAGAAATTGGAAAGTGCAGTGGTCTCACCAAGTCGGAGATATTCGTCAACCGT
GTCAGCCGCAGAACCGCTGTCTCTGACTGCCTTCGGGCTCTCCTACCTCTCTCGTCGCCGGATCCTCTTTTCTCGTCACT
GCATAAACCCTAGCTTTGTGGATTCAATTCGTTATCATGGATCAACAGCGAAGGATGATGCTGCCCCGTTTGTTTCTGTA
TATAGGCTTCTGATTGATAATCTTATTAAAGCTAAGAGGTTGGAGATGGCTCTTACGCTTCTTGAAGAGTCTGCCACGTT
GGTTAGCTACGGTAGCACGTATAATATGTTCGCTTTTCGGTTGTTCTCGGAGATGACGAAGAAAGGTGTCAGTCCGGATA
TGCAAACATTCTGTAGTCTTGTCAAGGGACTTTTCCGGGATAGGAAGATCAGTGAAGCACTTTTGCTTCCGGATTTCGTA
TCGCATATGTTAGATGGTGCATCTGATGCTGAGCATCCTACTCAAAACCTGAAATTGCCAAGGTTGGGAGCATCGGATAA
CGTATTGGGGAGATCACCACGAGCATGTGGGGGCATTGGGTTTCTGGGACCAAAATCATTGGAAACTGCATCAATGCTTC
ATAAAGCAGAGAAAACAGTCGATATAGAGGAGGTGGGTGTGATCCATAGGTCATTCAACAACCATCCAGTGCCTGGTACA
TTATCAGGTAATGAACCTGCCGAAGCTCTTATTAGAAGAAAAGTGTGGACGAAATGGTCTGAGGACAACAACTTTTATGA
AGCAGTAATTACACAATACAGTGCAGTGGAGTTTTTCCCCAACAAAGCGAAAAAAACAGAGATTGTGTTTGTTTCTCCAA
CGGGTGAGGAGTTCAGTAATAGAAAGCAGCTGGAGCAGTACCTCAAGTCACACCCTGGAAGCCCTGCGATCGCAGAGTTT
GATTGGACCACTAATAAAGAGCCACTCAAGAAACGAGGTCGAACTAAATCTTCAGGGTCAAAGAAAGATACAGATGAAGG
TGAGAAACCAGAGGGAGGAGTGGAAAACTCTAATGTGCAAGAAGAAGATTCTGAAATGACTCATCCAAAGGAGAACGAGA
ATTTAAATGTTAAGGATAGCTTTGGTGAAATTGAGAAGGCAGACGACATGGTGTCAGAGGAGAAAGACAACGTCAGGAGC
AGAAGCTATTCAATAGCCTTGCACTGCCCTGCTTCTGTAAGCTTATCAAACTACTATCTTGAGGATACTTAA