Details for Kale Locus Bo5g126610

Position : C5 ( 5`- 38991772 .. 38993720 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126610

Protein [Map View]
MSTETGVPLRRRSNSLNGHHSNDVAFDGTVPSMENNIVKKTDDGYANGGGKASFMTWTARDAIYVARVHWIPCVFAVGVL
FFMGVEYTLQMIPARSEPFDVGFVATRSLNSVLANSPGLNTVLAALNTVFVGMQTTYIVWTWLMEGRPRATISACFMFTC
RGILGYSTQLPLPQEFLGSGVDFPVGNVSFFLFYSGHVAGSMIASLDMRRMQRLRLAMLFDILNVLQSIRLLGTRGHYTI
DLAVGVGAGILFDSLAGKYEEMMSKRHNLGNGFSLISKDSLVN*

DNA
ATGTCAACTGAAACTGGCGTCCCTCTCCGTCGCAGATCTAACTCTCTTAACGGACATCACTCTAACGACGTCGCCTTTGA
CGGAACCGTCCCATCAATGGAGAACAACATTGTTAAGAAAACAGACGACGGCTACGCCAATGGAGGAGGAAAGGCGTCGT
TTATGACATGGACGGCGCGTGACGCTATCTACGTGGCGAGAGTCCATTGGATACCGTGTGTGTTCGCGGTTGGAGTTCTG
TTCTTCATGGGCGTCGAGTATACGCTTCAGATGATTCCCGCGAGGTCTGAGCCGTTCGATGTTGGGTTTGTGGCCACGCG
CTCTCTGAACAGCGTCTTGGCAAATTCACCGGGTCTTAACACCGTTTTAGCCGCACTAAACACGGTGTTCGTAGGGATGC
AAACTACGTATATTGTATGGACATGGTTGATGGAAGGAAGACCACGAGCCACCATCTCGGCTTGCTTCATGTTTACTTGT
CGCGGTATTCTTGGTTACTCTACTCAGCTCCCTCTCCCTCAGGAGTTTTTAGGATCAGGAGTCGATTTTCCTGTGGGAAA
CGTCTCATTCTTCCTTTTCTACTCGGGTCACGTCGCCGGTTCGATGATAGCATCCTTAGACATGAGGAGAATGCAGAGGT
TGAGACTAGCAATGCTTTTTGACATCCTCAATGTATTACAATCGATAAGGCTGCTCGGGACGAGAGGACATTACACCATC
GATCTTGCGGTCGGAGTTGGCGCTGGGATTCTCTTTGACTCGTTGGCCGGGAAGTACGAAGAGATGATGAGCAAAAGACA
CAATTTAGGCAATGGTTTTAGTTTGATTTCTAAAGACTCGCTAGTCAATTAA