Details for Kale Locus Bo5g126600

Position : C5 ( 5`- 38989457 .. 38990941 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126600

Protein [Map View]
MAAAANTAVFVSPSQPLSSKRNFLYSSTVSPIQRRFPRRKLELQVKAVATTLAPLEEIKEYKLPSWAMFEMGTAPVFWKT
MNGLPPTAGEKLKLFYNPAATKLTPNEDYGVAFNGGFNQPIMCGGEPRAMLKKDRGKADSPIYTMQICIPKHAVNLIFSF
TNGVDWDGPYRLQFQVPKRWQNKPIEFFNEGLAKELSQDGACERAIFPDSNIVATRCTMIANLTVEGGDRCNLDLVPGCM
DTNSEHFNPLANVDDGSCPLELSDSDE*

DNA
ATGGCTGCAGCTGCTAACACCGCCGTTTTTGTATCTCCTTCGCAGCCTTTATCCTCTAAACGCAATTTTTTGTACAGTTC
AACGGTTAGTCCAATACAGAGGAGATTTCCAAGGAGGAAACTTGAGCTGCAAGTAAAAGCTGTTGCCACCACTCTTGCAC
CCCTCGAAGAGATCAAAGAATATAAGCTTCCTTCATGGGCAATGTTCGAGATGGGGACAGCTCCAGTGTTCTGGAAAACC
ATGAACGGGCTTCCTCCAACCGCGGGTGAGAAGTTGAAACTTTTCTACAATCCAGCTGCAACCAAACTCACTCCTAACGA
GGACTATGGGGTTGCTTTCAACGGAGGATTTAACCAACCAATCATGTGTGGTGGAGAACCAAGAGCAATGCTTAAGAAAG
ATCGAGGCAAAGCCGATTCTCCCATTTACACTATGCAGATTTGCATTCCTAAGCATGCTGTGAATTTGATATTCTCGTTC
ACCAATGGTGTCGATTGGGATGGTCCATACAGACTTCAGTTCCAAGTCCCCAAGCGATGGCAAAACAAACCTATCGAGTT
CTTCAATGAGGGTCTAGCTAAAGAGTTGAGCCAAGATGGAGCCTGTGAGAGAGCAATATTTCCTGACTCGAACATAGTTG
CAACACGGTGCACTATGATTGCCAACTTGACGGTCGAAGGAGGAGATAGATGCAATCTGGACCTTGTTCCTGGGTGCATG
GATACAAACTCAGAACATTTCAACCCGTTGGCTAATGTTGATGATGGCTCTTGCCCTCTTGAGTTATCTGATTCTGATGA
ATAG