Details for Kale Locus Bo5g126580

Position : C5 ( 5`- 38983935 .. 38984435 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126580

Protein [Map View]
MDDNKNIIKALARWCLVLQAIMVSSNTVALKEPDYVNMNITIRNAMTGLLRPEVVYRCQSRRKDYGWHRSTKPGTQFSFQ
IILIKGESKIPAIHICRFRSALGTATLVIENTYLDAEMCPKSSCAHEATPKGILFRGLEWDFKTVFPKLKPVEYLELPWT
PWPNRI*

DNA
ATGGATGATAACAAAAACATCATCAAAGCCCTAGCTCGGTGGTGTCTTGTTCTGCAAGCCATCATGGTATCTTCCAACAC
CGTGGCTCTCAAGGAACCAGACTACGTAAACATGAACATAACAATACGTAATGCAATGACCGGGCTGCTCCGCCCGGAAG
TCGTCTATCGGTGCCAGTCCAGACGCAAAGACTATGGTTGGCATCGATCTACAAAACCAGGAACTCAGTTTTCATTTCAA
ATCATTCTCATTAAAGGCGAAAGCAAGATACCGGCGATTCACATCTGCCGTTTCCGGTCCGCTTTAGGAACCGCCACACT
CGTGATAGAAAACACTTATCTCGACGCCGAGATGTGTCCTAAATCTTCATGTGCTCATGAAGCGACACCGAAAGGGATCT
TGTTTAGAGGCCTTGAATGGGATTTCAAAACCGTGTTTCCAAAGCTCAAACCAGTTGAGTATCTAGAATTGCCGTGGACA
CCTTGGCCAAACAGAATATGA