Details for Kale Locus Bo5g126560

Position : C5 ( 5`- 38976619 .. 38978931 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126560

Protein [Map View]
MEDLRLSPLRLGSFKSSPPRGSPTFRRVHSGRTPRREVKANGGALQWFRSNRLLYWLLLITLWTYLGFYVQSRWAHVDDN
KVEFLRFGGKLREDVLHVEQSKRVVDGTNVVHVDVNKKMHVALAKKEDVTPRRSLSARRRRRRKAGRSSRSKTQKVRKVV
EDLDEQDPELPKTNVTYGKLFGSFGSLEDKILEWSPQKRSGTCDRKSDFKRLVWSRRFVLLFHELSMTGAPISMMELASE
LMSCGATVYAVVLSRRGGLLQELIRRRIKVVEDKGELSFKTAMKADLVVAGSAVCATWIDQYMDHFPAGGSQIAWWVMEN
RREYFDRAKPVLDRVKLLIFLSEVQSKQWLTWCEEEHIKLRSQPVIVSLSVNDELAFVAGISSSLNTPTLTTEMMKAKRQ
ALRESVRKEFGLTDKDMLVMSLSSINPTKGQLLLLESAALALERANEPEQVAKGTQSKIKNLNGIKKEKISLSVRHRLRG
SARKMKIKSRVVDNPSVLSATGKRKLLFSANVTQKQDLKLLLGSVGSKSNKVAYVKEMLNFLSKNGNLSNSVVWTLATTR
VASLYSAADVYVTNSQGIGETFGRVTIEAMAYGLPVLGTDAGGTKEIVEHNVTGLLHPVGRLGNKVLAQNLLFLLRNPST
RLQLGSEGRKKVEKMYMKQHMYKRFVDVLVKCMRP*

DNA
ATGGAGGATCTACGTCTATCACCACTGCGACTAGGTAGCTTCAAGTCGTCACCTCCAAGGGGCTCACCTACATTCAGGAG
AGTACATTCTGGCAGGACTCCACGTAGAGAGGTCAAAGCTAATGGCGGAGCTCTTCAGTGGTTCAGAAGTAACCGGCTGC
TCTATTGGCTGCTTTTAATTACTCTCTGGACCTATCTTGGATTCTATGTTCAGTCTAGATGGGCGCATGTTGATGATAAC
AAAGTTGAGTTCTTGCGCTTTGGGGGCAAACTTAGGGAAGATGTTTTGCATGTGGAGCAGAGTAAACGAGTAGTGGATGG
TACTAATGTAGTACATGTGGATGTTAATAAGAAGATGCATGTGGCTCTGGCCAAGAAAGAGGATGTCACACCTAGGCGAA
GCTTGAGTGCCAGGAGGAGGAGAAGGAGAAAGGCTGGTCGTAGCTCACGTAGTAAGACTCAGAAGGTGAGAAAAGTTGTG
GAGGACTTGGATGAGCAAGATCCAGAGCTTCCAAAGACGAATGTTACCTATGGTAAGCTTTTTGGTTCTTTTGGATCACT
AGAGGATAAGATTCTTGAGTGGAGTCCGCAGAAGCGATCAGGGACGTGTGACAGGAAGTCAGACTTTAAACGCCTTGTTT
GGTCGAGGAGATTCGTCCTGCTTTTCCATGAGCTTTCAATGACCGGTGCTCCAATCTCGATGATGGAGCTGGCTTCCGAG
CTTATGAGCTGTGGCGCAACGGTCTATGCGGTGGTTCTGAGCAGAAGGGGTGGTTTGTTGCAAGAGCTCATAAGGAGAAG
GATCAAAGTGGTTGAAGATAAAGGAGAACTCAGCTTCAAAACCGCCATGAAAGCAGATCTTGTCGTTGCAGGATCAGCTG
TTTGTGCTACATGGATTGATCAATACATGGATCACTTTCCAGCTGGTGGAAGTCAAATAGCTTGGTGGGTAATGGAGAAC
CGGAGAGAGTACTTTGATCGGGCAAAGCCTGTACTTGACCGGGTGAAGCTGCTTATTTTTCTATCTGAAGTACAGAGCAA
ACAGTGGTTAACATGGTGCGAAGAGGAGCACATAAAGCTTAGGTCTCAGCCAGTTATCGTTTCGCTCTCTGTTAATGATG
AGTTGGCTTTCGTAGCCGGGATTTCCAGTTCGCTGAATACTCCAACACTGACCACAGAGATGATGAAGGCGAAAAGACAA
GCACTACGTGAATCAGTCAGAAAGGAATTTGGTTTGACAGATAAAGATATGCTTGTGATGTCTCTTAGCAGCATTAATCC
GACGAAAGGACAACTTCTTCTCCTTGAATCTGCCGCCTTGGCACTAGAAAGAGCAAATGAACCAGAACAAGTTGCTAAAG
GTACTCAGTCCAAAATCAAGAACCTCAATGGCATCAAGAAAGAAAAGATTAGTCTTTCAGTCAGACATCGGTTAAGAGGT
TCAGCAAGAAAGATGAAAATCAAGTCTCGTGTTGTTGATAATCCGTCTGTTCTGTCTGCCACCGGTAAAAGGAAGCTGCT
GTTCTCTGCCAACGTAACACAGAAACAAGACCTTAAGCTTCTTCTTGGATCAGTTGGGTCCAAGAGCAACAAAGTTGCAT
ACGTTAAGGAAATGTTGAACTTCTTGTCAAAGAACGGAAACTTATCGAACTCGGTTGTGTGGACTTTAGCGACCACTCGT
GTTGCCTCACTATACTCTGCAGCAGATGTCTACGTAACAAACTCCCAGGGAATTGGTGAAACATTTGGGAGAGTGACTAT
CGAAGCAATGGCTTATGGTCTTCCGGTGCTTGGAACAGACGCAGGAGGAACAAAGGAGATAGTGGAGCACAATGTGACAG
GGCTGCTACACCCTGTGGGGAGGCTAGGTAACAAAGTGCTAGCTCAGAATCTCTTGTTTCTGCTTAGAAACCCATCTACA
AGGCTACAGCTAGGAAGCGAAGGACGTAAGAAGGTTGAGAAGATGTACATGAAGCAACACATGTACAAGAGATTTGTAGA
TGTTCTAGTCAAATGCATGAGACCCTAA