Details for Kale Locus Bo5g126540

Position : C5 ( 5`- 38950747 .. 38955341 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126540

Protein [Map View]
MGTKFLALCLSLCLILSSFYKVSCQDEGTTGLNLDLIEREYQASLQGNEGGDQISGQKNSTVTDNNTISLSLSEESVETT
KDSADTSSQLGVVTDEVNKPSSMLDHIELEFQAQINELKQAGSDGINKNDESKDDQELAAQRKKMLEEIEREFEAAAAGF
EQFKIDDSTQGEDDEQSAMRKSMLEEIERDFEAATKGLEQLKADDLTGVNDAEHAARRQKMLEEIEREFEEATKGLEELR
HSTSSTDDESLSARRQSMLDEIERDFEAATSGLKQLKINAYTVEDDDKEQAARRQSMLDAIEREFEAVTESFKQIDDLAD
NKDEGDESAMRQSMLDEIEREFEAATSSLKKLNLDDFTEGDDSAHNARRNSMLEAIEREFEAATKGLEELKASDSTQGND
DDEHSARRKSMLDAIEREFEAATRGLAEIKNHEEQAETQGNSMLEEIEREFEAAAASAKAAEKDSAAKNPPTISIVQKTG
GFDSLLKPADGVCGCFNKDKEGLKADTDSSINLAEILAEKSKSQDSETSSLTTSLTNLVHTHRKETTSKVSTVLGSSVTS
TTSESSATSETLESLKQTLKKLRGLTARDLVHHPNFDEIIEAGTRYEVLSSASIGYISLLAKYKTVIKEGLEASQRVHLA
RTRAKLLKETAVEKQRAVDAEFALAKSLAQGGDALSIKIFAIKKLLVKLEAEKVSVDLKFKSTETNLGRLLKEASQAYEE
YHAAVRKAKDEQAAEEFALETTKRAEHIWVEFLSSLN*

DNA
ATGGGAACCAAGTTCTTAGCTCTGTGTTTGTCTCTGTGTCTCATCCTCTCAAGCTTTTATAAAGTTTCTTGCCAGGATGA
AGGAACTACAGGTTTGAATTTAGATCTGATTGAGCGTGAATATCAAGCTTCTCTCCAAGGCAACGAAGGAGGAGACCAGA
TCAGTGGTCAGAAAAACAGTACAGTGACTGATAACAACACAATATCTCTGTCTCTATCAGAAGAATCTGTGGAAACTACT
AAAGATTCTGCTGATACCTCGTCTCAGTTAGGAGTTGTTACTGATGAAGTCAATAAACCTTCGAGTATGTTGGACCATAT
CGAACTTGAGTTCCAAGCACAAATCAATGAACTTAAACAAGCTGGATCTGATGGTATCAACAAAAATGATGAATCTAAGG
ATGATCAAGAACTAGCTGCTCAGAGGAAGAAAATGTTGGAAGAGATTGAACGCGAATTTGAAGCTGCTGCTGCTGGATTT
GAACAATTCAAGATTGATGATTCCACTCAAGGAGAAGATGATGAACAATCTGCAATGAGAAAGAGCATGCTAGAAGAGAT
TGAACGCGATTTTGAAGCTGCTACAAAAGGTCTTGAACAACTAAAGGCTGATGATCTAACCGGAGTCAACGACGCAGAAC
ACGCTGCAAGGAGACAGAAGATGTTGGAAGAGATTGAAAGAGAGTTTGAAGAAGCTACAAAAGGTCTTGAAGAACTAAGG
CATTCAACCTCAAGCACAGATGATGAATCTCTCTCTGCAAGGAGACAAAGTATGCTAGATGAGATCGAACGTGACTTTGA
AGCTGCTACAAGTGGTCTTAAACAGCTTAAGATTAATGCTTACACTGTCGAAGATGATGACAAAGAACAAGCTGCCAGGA
GACAAAGTATGCTAGATGCAATTGAGCGTGAGTTCGAAGCCGTTACAGAAAGTTTTAAGCAGATTGATGATCTTGCTGAT
AACAAAGATGAGGGAGACGAATCTGCAATGAGGCAAAGCATGTTGGATGAGATTGAGCGTGAATTCGAAGCTGCTACAAG
TAGTCTTAAGAAACTAAACCTTGATGATTTCACTGAAGGAGATGACAGTGCACATAATGCAAGGAGAAATAGCATGCTTG
AAGCTATCGAACGCGAGTTTGAAGCTGCTACAAAAGGTCTTGAAGAGCTAAAGGCTAGTGATTCAACCCAAGGCAATGAT
GATGATGAACACTCTGCAAGGAGAAAGAGTATGCTTGATGCTATTGAACGCGAGTTTGAAGCTGCCACAAGAGGCCTTGC
AGAGATCAAGAATCATGAAGAACAAGCTGAAACTCAGGGAAACAGTATGTTGGAAGAAATAGAACGCGAATTTGAAGCAG
CTGCGGCAAGTGCAAAGGCTGCTGAAAAAGACTCAGCTGCAAAGAATCCACCAACCATAAGTATAGTGCAGAAAACTGGT
GGGTTTGACAGTCTTCTAAAGCCTGCAGATGGTGTCTGTGGTTGTTTCAACAAAGACAAAGAGGGTCTTAAGGCAGACAC
AGATTCTTCCATTAACCTAGCAGAGATACTCGCTGAAAAATCAAAATCCCAGGACTCAGAGACCTCTAGCCTCACCACAT
CACTGACCAATCTTGTCCACACCCATAGAAAAGAAACAACCTCAAAGGTAAGCACAGTCCTTGGCTCATCAGTTACTTCC
ACAACAAGCGAATCATCCGCTACATCAGAAACCCTAGAGAGCTTAAAGCAAACCCTAAAGAAGCTACGCGGTCTAACCGC
ACGTGACCTAGTACACCACCCGAACTTCGACGAGATTATAGAAGCCGGTACACGTTACGAGGTACTCAGCTCAGCTTCCA
TTGGTTACATCTCTTTACTAGCCAAATACAAAACCGTCATCAAAGAAGGACTCGAGGCTTCTCAGAGAGTCCACCTCGCT
CGAACCCGCGCCAAACTTCTCAAAGAAACCGCCGTGGAGAAGCAGAGAGCCGTGGACGCGGAGTTCGCGCTCGCTAAGAG
TCTTGCTCAGGGAGGAGACGCGCTGTCCATCAAAATCTTCGCCATCAAGAAACTGTTGGTTAAGCTTGAAGCGGAGAAAG
TGAGCGTTGATCTGAAGTTTAAGTCGACGGAGACTAATCTAGGGCGACTTCTTAAGGAGGCTTCTCAGGCTTATGAAGAG
TATCATGCGGCTGTGCGTAAGGCAAAAGACGAGCAAGCTGCTGAGGAGTTCGCTCTTGAGACGACTAAGAGAGCAGAACA
TATTTGGGTTGAGTTTCTTAGTTCACTTAACTGA