Details for Kale Locus Bo5g126520

Position : C5 ( 5`- 38914608 .. 38917171 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126520

Protein [Map View]
MGFLVGATCFAPSPPLPLHSSTSQFLLLRSNNVAISKRRRPPPSASLRRQDANDDDVSVRRRDFVLMGVSVLPILQFRSP
AMADERGGNEIKTSSKLNQQTEVAVSEEGTSPNPFLSLLNGLGIFSAGVLGALYALARQDAQAAEEAIESLKNQLKDRDR
ASITKEKDSEARLQHEQEERNKERKKAQEDQFSLISQLNSAKDVVTGLGREISSEKKLCEELRVQIEGLQSNLSKAGEDK
TALDTKLKEKLGLIEELQDRINSLSLELKDKEEETQRISTLLAAKEAELEKLNSAYTQANRDLAGAKSETKQLKEEVTRS
QTELELKNSTIEELNARISTLEAEKESYIRKLDDVSKEYNALKLTSETRAAADAEFISSKEKETQDLKEKLDHALKDLNE
SKDEVADLTEKYEDSKRMLDIEMTSVENLKHELEGTKKALWASRERVSDLETLLDESRALCSKFESEVAVVHAEFEKAKE
RYEQNLAEERRNSESFASKLAVEKDHLKKAGEELEELTREVEESSVKNQSLQKELVEVYKKAETTKKELEEEKRTVLALD
KEVKAMEKQMLMEKEARKSLEAELEEAVRSLDEMNRNTSTLSKELEKVNSHVSSLEDEKEVLQRSLQEAKNASKEAKENV
EDAHNLVISLGKEREALEKKVKKLEEDLGSAKGEILRMRSQQSSVKAVNSTDDEEKSDDKVTVKKAVRRRKSSTSS*

DNA
ATGGGTTTCCTCGTCGGAGCTACTTGCTTCGCTCCGTCTCCTCCTCTTCCTCTCCATTCTTCTACGTCGCAGTTCCTGCT
TCTCCGCTCCAACAATGTTGCTATCTCCAAGCGTCGCCGACCACCACCATCGGCTTCTCTCCGCCGTCAAGATGCAAACG
ACGACGATGTTTCCGTCAGAAGAAGAGATTTTGTCCTTATGGGTGTCTCTGTTCTTCCGATTTTGCAGTTCCGATCACCA
GCTATGGCTGATGAAAGAGGAGGCAATGAGATAAAGACATCATCGAAGCTTAATCAACAAACTGAGGTTGCAGTAAGTGA
AGAAGGAACATCCCCAAATCCGTTTCTCTCTCTCTTAAACGGTCTTGGAATCTTCAGTGCTGGTGTTCTTGGTGCACTCT
ATGCCCTGGCTCGGCAAGACGCACAAGCTGCTGAAGAAGCCATCGAATCTCTAAAGAACCAGTTGAAAGACAGAGACAGA
GCGTCGATTACCAAGGAGAAAGACTCTGAAGCAAGACTGCAGCATGAGCAGGAAGAGCGGAACAAGGAGCGTAAAAAGGC
ACAAGAGGATCAGTTTTCATTGATCAGCCAGTTGAATTCTGCAAAGGACGTGGTGACAGGATTAGGCCGGGAGATAAGCA
GCGAAAAGAAACTATGCGAGGAGCTTAGAGTTCAAATCGAAGGTCTGCAAAGTAATCTATCAAAGGCTGGTGAAGACAAA
ACGGCACTTGATACAAAGCTCAAAGAAAAGCTTGGTTTGATTGAGGAGCTACAAGATCGGATCAACTCACTTAGTTTGGA
GTTGAAAGATAAGGAAGAAGAAACTCAACGCATTAGCACATTACTGGCTGCAAAGGAAGCAGAACTGGAAAAACTCAACT
CTGCTTACACTCAAGCTAACCGAGATCTTGCTGGAGCAAAATCAGAAACCAAACAGCTAAAGGAAGAAGTCACAAGAAGT
CAAACTGAGTTGGAGTTAAAGAACTCTACCATCGAGGAGCTCAACGCCAGAATAAGCACTTTAGAGGCTGAGAAGGAGAG
TTACATCCGAAAGCTTGATGATGTCTCAAAAGAGTACAATGCTTTGAAATTGACTTCTGAAACGCGAGCAGCTGCTGATG
CAGAGTTCATTAGCAGTAAAGAGAAGGAGACTCAGGACCTAAAGGAAAAGCTGGATCATGCGCTTAAGGATCTAAATGAG
AGTAAAGACGAAGTTGCTGACCTTACTGAGAAGTACGAAGACTCGAAGAGAATGCTGGATATAGAAATGACTAGTGTAGA
AAACTTGAAACATGAGCTTGAAGGAACCAAGAAAGCACTCTGGGCGTCGAGAGAACGTGTCTCTGACCTGGAGACGCTGC
TGGATGAGTCGAGAGCTTTGTGTTCAAAGTTTGAATCAGAGGTTGCTGTTGTTCACGCAGAGTTTGAGAAAGCTAAGGAA
AGATATGAACAGAATCTTGCTGAGGAAAGACGAAACAGTGAGAGTTTCGCTAGCAAACTTGCAGTGGAGAAAGATCATCT
GAAGAAAGCTGGAGAAGAGCTTGAAGAACTGACCCGTGAAGTGGAAGAATCTTCTGTCAAGAACCAGAGCCTCCAGAAAG
AACTAGTGGAGGTTTACAAGAAAGCCGAAACCACTAAGAAGGAACTGGAAGAGGAGAAGAGGACGGTTTTGGCATTGGAC
AAAGAGGTGAAAGCAATGGAGAAGCAGATGTTGATGGAGAAGGAGGCGAGGAAGTCCCTTGAAGCAGAACTCGAAGAAGC
AGTCAGGTCCTTAGATGAGATGAACAGAAACACATCAACACTGTCAAAGGAGCTTGAGAAGGTGAATAGCCATGTCTCGA
GTTTGGAGGACGAGAAAGAAGTGCTTCAAAGATCACTACAAGAGGCGAAGAACGCATCAAAAGAAGCTAAGGAAAACGTG
GAAGACGCACATAACCTCGTGATAAGTCTAGGGAAAGAGAGGGAAGCGCTAGAAAAGAAAGTGAAGAAGCTCGAGGAGGA
CTTGGGCTCTGCAAAGGGAGAGATACTGCGTATGAGGAGCCAACAGAGTTCTGTAAAAGCTGTGAATAGTACAGATGATG
AAGAGAAGAGTGATGATAAGGTTACTGTGAAGAAAGCTGTCAGGAGGAGAAAGAGCAGTACCAGTTCTTGA