Details for Kale Locus Bo5g126500

Position : C5 ( 5`- 38905261 .. 38907309 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126500

Protein [Map View]
MLWPITLLTLSLLLGQSCCATDTLLQGQYLKHGQELVSAFNIFKLKFFSFENSSNLYLGIWYNDLYLNGNKQYAHIQDRA
VWIANRNNPIPGRSGSLTVDSLGRLKILRGASKSLLEITSTETTGNTTLKLLDTGNLQLQEMDSDGSVRRVLWQSFDYPT
DTFLPGMKLGFNVKTGKRWELTSWLGDTLPASGSFVFGMDANITNRLIILWRGNMYWASGLWFKDRFSLEEFNSEFVFSY
VSTESEHYFMFSVDRHYGDTVFPTITIDQQGILHINRLDREVTHVRCSPFTIGDEVDNECYRRDPRGCLNAGCIVPDMPS
GFRNCSPYGYTYFRETVSAFSGNGFVLDETGGRLSSADCRVMCLQNCSCLAYASTNGDGTGCEIWNIDPSNKRSASHRPR
TIYILVKGYGVHQPNEKAATWLVVVASLFLMIPVTWFIIYLILRKFKVKVSVIFRGMFYFLWGEVIPQMIGCIRRRVQTP
RVGSTIDQEMLLRELGIDRRGRRHRRSARKSMLDFPP*

DNA
ATGTTGTGGCCAATCACTCTTTTAACTTTATCTCTCTTGTTAGGACAATCATGTTGTGCAACCGACACGCTGCTGCAGGG
ACAGTACTTGAAACATGGGCAAGAGCTCGTTTCAGCTTTCAACATCTTCAAGCTCAAGTTTTTCAGCTTCGAGAACTCAA
GCAACCTGTATCTTGGAATCTGGTACAACGATTTGTATCTCAATGGTAACAAGCAGTATGCTCATATCCAGGACAGAGCT
GTCTGGATTGCTAACCGCAACAATCCAATCCCAGGACGTTCTGGAAGCCTCACTGTTGACTCACTCGGCAGATTGAAGAT
CTTAAGAGGAGCTTCAAAAAGCCTGCTTGAGATAACTTCCACGGAAACCACTGGAAACACGACCCTTAAGCTGTTGGATA
CAGGAAATCTTCAGCTTCAGGAGATGGACTCTGATGGATCGGTGAGGAGGGTTTTGTGGCAAAGTTTTGATTATCCGACG
GATACCTTTCTCCCTGGAATGAAGCTTGGTTTCAATGTCAAGACTGGAAAGAGATGGGAGCTGACGTCATGGCTAGGTGA
TACTTTACCTGCTTCTGGATCTTTTGTCTTTGGAATGGATGCGAATATTACAAACCGGTTAATCATATTGTGGCGTGGAA
ACATGTATTGGGCAAGTGGGCTTTGGTTTAAGGATCGGTTCTCCTTGGAGGAATTTAACAGTGAGTTCGTCTTCTCTTAT
GTTTCAACCGAGAGTGAACACTATTTTATGTTTTCGGTTGATCGCCACTATGGGGATACAGTATTCCCCACGATAACGAT
AGACCAACAGGGCATTTTGCATATTAACAGGCTTGATAGAGAGGTCACTCATGTCCGCTGCTCTCCTTTCACCATCGGTG
ACGAGGTTGATAATGAATGTTATAGGAGAGATCCAAGGGGGTGTTTGAACGCAGGTTGCATAGTCCCGGATATGCCATCT
GGGTTCAGGAACTGTTCGCCCTATGGGTATACCTATTTCCGGGAGACAGTATCAGCTTTTTCAGGCAATGGGTTTGTACT
TGATGAGACTGGTGGAAGGCTCAGTTCAGCTGATTGCCGTGTTATGTGTCTGCAAAACTGTTCTTGTCTTGCATATGCTT
CAACCAATGGGGATGGTACGGGTTGCGAGATCTGGAATATTGACCCTTCCAACAAAAGGTCGGCTTCTCACCGTCCCAGA
ACAATATATATTCTCGTAAAAGGATATGGGGTACATCAGCCGAACGAAAAGGCGGCGACTTGGCTAGTTGTTGTGGCATC
ACTGTTCCTAATGATACCTGTAACTTGGTTCATCATCTATCTTATTCTGAGGAAATTTAAAGTAAAAGTAAGTGTCATAT
TTCGTGGAATGTTCTACTTCTTATGGGGGGAAGTCATTCCGCAAATGATTGGTTGCATAAGGAGGAGGGTTCAAACACCG
AGGGTTGGTTCAACAATAGACCAAGAAATGCTACTACGTGAACTGGGAATTGATAGGAGAGGCCGCCGGCACAGGAGAAG
TGCAAGGAAGAGTATGTTGGATTTCCCTCCTTAA