Details for Kale Locus Bo5g126470

Position : C5 ( 5`- 38893476 .. 38894260 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126470

Protein [Map View]
MSSKQGGKLKPLKQPKSGKKEYDEHDKELIQKKKDEEKALKELRSKASQKGSFGGAGLKKSGKK*

DNA
ATGTCTTCCAAGCAAGGAGGGAAATTGAAACCCTTGAAGCAGCCCAAGTCTGGTAAGAAGGAATACGATGAGCACGATAA
GGAGTTAATTCAGAAAAAGAAGGATGAAGAGAAGGCGCTTAAAGAACTCAGGAGCAAGGCATCACAAAAGGGATCGTTCG
GTGGTGCAGGTCTTAAGAAAAGTGGCAAGAAATAA