Details for Kale Locus Bo5g126440

Position : C5 ( 5`- 38878682 .. 38879523 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126440

Protein [Map View]
MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLKNVPRRFKTGFRE
GTEAKPRNKGAAASSA*

DNA
ATGACAAAGGGAACAGGGAGTTTTGGTAAGAGGAGGAACAAGAGTCACACGCTGTGTGTGAGATGTGGACGTCGTAGCTT
CCACATCCAGAAGAGTCGCTGCTCTGCCTGCGCTTACCCCGCCGCTCGCAAGAGGACCTACAACTGGAGTGTGAAGGCAA
TCAGGAGGAAGACAACCGGAACCGGCAGGATGAGATATCTCAAAAACGTTCCTCGCCGTTTCAAGACCGGTTTCAGAGAA
GGTACTGAAGCCAAGCCAAGGAACAAGGGAGCAGCTGCTTCATCAGCCTAA