Details for Kale Locus Bo5g126420

Position : C5 ( 5`- 38870030 .. 38870402 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126420

Protein [Map View]
MLEGKAKVEDTDMPVKMQMKALNIASQSLDLFDLSDCQPIAAHIKKEFDERYGSGWQCVVGSNFGCFFTHSKGTFIYFHL
GTLKFLIFKGATL*

DNA
ATGCTGGAAGGGAAAGCAAAGGTGGAAGACACAGATATGCCAGTGAAGATGCAAATGAAAGCATTGAACATTGCTTCTCA
ATCTCTCGATCTTTTTGATCTATCTGACTGTCAACCTATCGCTGCTCACATCAAGAAGGAGTTTGATGAGAGATATGGAA
GTGGTTGGCAATGCGTGGTGGGATCAAACTTTGGGTGTTTCTTCACACATTCTAAAGGAACTTTCATCTATTTCCATTTG
GGAACCCTCAAATTCCTCATCTTCAAAGGAGCCACTCTTTAG