Details for Kale Locus Bo5g126380

Position : C5 ( 5`- 38852342 .. 38853565 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126380

Protein [Map View]
MGKWAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVIRELETDPLFNSGRGSALTEQGTVEM
EASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFSGAEEFARKQGVEIVDNEYFITDDNVGMLKLAKEANSI
LFDYRIPLGCAGAAVTDSPLQMNGLPISIYAPETVGCVVVDREGRCAAGTSTGGLMNKMMGRIGDSPLIGAGTYASELCG
VSCTGEGEAIIRSTLARDVSAVMEYKGVGLQEAVDFVIKHRLDEGFAGLIAVSNKGEVVCGFNCNGMFRGCATEDGFMEV
AMWE*

DNA
ATGGGTAAATGGGCAATCGCCGTACACGGTGGCGCAGGAATCGACCCAAATCTTCCCGTAGAGAGACAAGAACAGGCGAA
ACAGCTTTTAACTCGCTGTCTTAACCTCGGCATAGCAGCTTTACGTTCCAACGTTTCCGCAATTGACGTCGTTGAGCTCG
TCATTAGAGAATTAGAGACGGATCCTCTGTTTAACTCAGGCCGTGGATCTGCTTTAACGGAACAAGGAACGGTGGAGATG
GAAGCGAGCATTATGGACGGTACGAAGAGACGATGCGGCGCCGTTTCGGGGATAACCACCGTGAAGAACCCTATCTCTCT
CGCTCGTCTCGTTATGGACAAATCTCCCCACTCTTACCTAGCCTTCTCAGGCGCGGAGGAGTTCGCTCGCAAACAGGGAG
TTGAGATTGTAGACAACGAGTACTTTATCACGGACGACAACGTGGGTATGCTCAAGCTGGCGAAAGAAGCCAACTCCATC
TTGTTTGATTACCGTATCCCGCTAGGATGCGCCGGTGCAGCCGTAACCGACAGTCCTCTCCAGATGAACGGTCTTCCGAT
AAGCATTTACGCGCCGGAGACAGTAGGATGTGTTGTGGTGGACAGAGAAGGACGGTGTGCTGCGGGAACATCAACCGGTG
GTCTGATGAACAAGATGATGGGAAGGATAGGAGACTCGCCACTGATAGGAGCAGGGACGTATGCGTCTGAGCTTTGTGGC
GTGTCGTGTACAGGAGAAGGTGAAGCTATCATAAGGTCGACGCTAGCGCGTGACGTGTCGGCTGTTATGGAGTATAAAGG
TGTTGGGCTTCAGGAAGCGGTTGATTTTGTTATTAAGCATCGACTGGACGAAGGGTTCGCTGGACTTATTGCTGTGTCGA
ATAAAGGAGAGGTGGTTTGTGGTTTTAACTGTAATGGGATGTTTAGAGGATGTGCAACTGAAGATGGGTTCATGGAAGTT
GCTATGTGGGAGTGA