Details for Kale Locus Bo5g126370

Position : C5 ( 5`- 38846789 .. 38850586 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126370

Protein [Map View]
MTATLKSFNYFSYIINSRLQNSTILSYRRRRRLPRSQPPTSCLNPGFRFFQSNHLFCTQSGSLMEVFKAVCSEGSNSCDR
LAIKADEKSYSYGQLTSSALTISKLFCREDTTTGGETKKYEGFGSLKGARVGIVAKPSAEFVAGVLGTWFSGGVAVPLAL
SYPEAELLYVMSNSDISVLLSTEDHSETMKTIAAKSDARFLLIPPLLNSTSETVTNNQFQDDSFGEDGKLLDDPALIVYT
SGTTGKPKGVVHTHKSINSQVRMLTEAWEYTSADHFLHCLPLHHVHGLFNALFAPLYARSSVEFLPKFSVSGIWRRWRES
YPVNDDKTDNPITVFTGVPTMYTRLIQGYEAMDQETKESSAFAAQKLRLMMSGSSALPRPVMHQWESITGHRLLERYGMT
EFVMAISNPLRGARKAGTVGEPLPGVEAKIVQDVNDADGVGEICVKSPSLFKEYWNLPEVTKESFTEDGYFKTGDAGRVD
EDGYYVILGRTSADIMKVGGYKLSALEIESTLLEHPTVAECCVLGLPDKDYGEAVTAIIVAEAGAKRKRDDESKPVMTLE
ELCGWAKDKLAPYKLPTRLLIWESLPRNAMGKVNKKELKKSLDHQE*

DNA
ATGACAGCTACTTTAAAGAGTTTCAACTACTTCTCTTACATCATTAACTCTCGGCTCCAGAACTCCACAATTCTGTCCTA
TCGTCGTCGTCGTCGTCTTCCTCGATCACAGCCACCTACTTCGTGTCTGAATCCTGGGTTTCGATTCTTCCAATCCAACC
ATCTCTTCTGTACACAGTCTGGTTCACTCATGGAAGTGTTTAAAGCGGTTTGTTCAGAAGGGTCTAATTCCTGTGATAGG
TTAGCGATTAAAGCCGATGAGAAGAGTTACTCTTATGGCCAGCTTACATCCTCTGCCTTGACAATATCTAAATTGTTCTG
CCGCGAGGATACTACAACTGGAGGTGAGACTAAGAAGTATGAAGGGTTTGGTAGTCTTAAAGGAGCTAGAGTTGGAATTG
TGGCGAAACCTTCAGCTGAGTTTGTTGCTGGAGTCCTTGGGACTTGGTTTAGTGGTGGCGTTGCAGTTCCACTTGCGCTC
AGCTACCCTGAGGCTGAACTTTTATATGTCATGAGTAATTCGGACATATCTGTGTTATTGAGCACGGAGGACCATAGTGA
AACTATGAAAACTATAGCAGCAAAGAGTGACGCTCGCTTTCTTCTGATTCCCCCTCTTCTTAACTCAACTTCAGAAACTG
TTACAAACAATCAGTTTCAAGATGACAGTTTTGGAGAAGACGGAAAGCTTCTAGATGATCCAGCATTGATCGTCTACACT
AGTGGTACAACTGGTAAACCAAAAGGAGTTGTCCATACTCACAAAAGCATAAACTCCCAGGTTAGAATGCTAACTGAAGC
TTGGGAGTACACATCTGCTGATCACTTTCTCCATTGCCTCCCACTACATCATGTTCATGGCCTTTTTAACGCTTTATTTG
CTCCTCTTTACGCGCGATCTTCGGTTGAGTTTTTGCCCAAATTTAGTGTTAGTGGAATCTGGCGCAGATGGCGTGAGTCA
TATCCGGTGAATGATGACAAAACCGATAACCCCATAACTGTATTTACTGGCGTTCCAACCATGTATACTCGGTTGATACA
AGGTTATGAAGCAATGGATCAAGAAACGAAAGAGTCAAGCGCCTTTGCTGCGCAGAAGCTTCGTTTAATGATGTCTGGCT
CCTCTGCTCTTCCTAGACCTGTCATGCATCAGTGGGAAAGTATCACAGGTCATCGTCTTTTGGAACGATATGGCATGACT
GAGTTTGTAATGGCAATTTCAAACCCTCTACGAGGTGCAAGGAAAGCAGGAACTGTAGGCGAACCGCTTCCCGGGGTGGA
GGCTAAGATTGTACAAGATGTAAATGATGCTGATGGAGTGGGTGAGATTTGCGTAAAGAGCCCATCTTTGTTCAAGGAGT
ACTGGAATCTTCCAGAAGTAACTAAAGAATCATTCACGGAAGATGGATACTTCAAGACGGGAGATGCTGGTAGAGTGGAT
GAAGATGGATATTACGTGATTCTAGGACGTACTAGCGCTGATATAATGAAAGTTGGAGGATACAAGTTGTCTGCCTTAGA
AATCGAATCTACCCTACTCGAGCACCCTACGGTTGCAGAATGTTGTGTGTTGGGGTTACCAGACAAAGACTATGGGGAAG
CGGTTACAGCGATAATTGTAGCTGAGGCTGGAGCAAAGAGGAAAAGAGATGATGAGTCAAAACCTGTGATGACCTTAGAA
GAACTCTGCGGTTGGGCTAAAGACAAGCTTGCTCCTTACAAGCTGCCAACACGTTTGCTAATATGGGAGAGCTTACCCCG
CAACGCCATGGGAAAGGTAAACAAGAAAGAGCTAAAGAAATCTCTGGATCATCAAGAGTAA