Details for Kale Locus Bo5g126360

Position : C5 ( 5`- 38841238 .. 38845057 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126360

Protein [Map View]
MENPPDQTESKEMMLPPRTRRPKGGLLTMPFIIANEGFEKVASYGLLQNMILYLMSDYGLGVVKGQTVLFMWVAATNFMP
LVGAFLSDSYLGRFLTIAIASLSSFLGMVLLWLTAMLPQVKPSPCIASAGTNCSSPAATSSQLALLYSAFALISIGSGGI
RPCSLAFGADQLDNKENPKNERVLESFFGWYYASSSVAVLIAFTVIVYIQDHLGWRIGFGIPAILMLLASIVFAFASPLY
VKRNVTKSLFTGLAQAAVAAYVNRKLMLPGQSDSYGCYHHLEDSELKAPSDKLRFLNKACVIRNRDEDIGSDGLALNPWR
LCTTDQVEELKALVKVIPVWSTGIMMSINVSQNSFQLLQANSMDRRLSNDSTFKIPAGSFGMFTIIALISWVVLYDRAIL
PLASKIRGRPVRINVKIRMGLGLFISFLAMAVSATVEHYRRRTAISQGLANNATATVNISAMWLVPQYVLHGLAEALTGI
GQTEFFYTEFPKSMSSIAAALFGLGMAVANILASVILNVVKNSSKKGGVSWIEDNINKGHYDYYYWVLAIMSFVNVIYYV
ACSWSYGPTVDQVRNDKVNGVREEEQDEVVKIN*

DNA
ATGGAGAACCCTCCGGATCAAACAGAGTCAAAGGAGATGATGCTTCCACCCAGAACCAGAAGACCAAAGGGAGGACTTCT
CACTATGCCCTTCATCATTGCAAACGAGGGGTTTGAGAAAGTGGCGAGCTACGGATTACTACAGAACATGATACTTTACC
TGATGAGTGATTACGGTTTAGGAGTTGTGAAAGGACAAACCGTGTTGTTCATGTGGGTTGCTGCTACTAACTTCATGCCT
CTCGTTGGAGCTTTTCTCTCAGATTCGTATTTGGGTCGCTTTCTCACCATCGCCATTGCCTCTCTCTCCAGTTTCCTGGG
GATGGTGCTTCTATGGCTAACGGCGATGTTACCACAAGTGAAGCCATCACCGTGTATAGCATCTGCCGGAACCAACTGCA
GTTCCCCGGCAGCCACATCTTCTCAACTGGCACTTCTGTATTCCGCATTTGCACTTATATCGATCGGATCAGGTGGTATC
AGGCCATGTTCTTTAGCCTTTGGTGCTGATCAGTTGGATAACAAAGAGAATCCCAAGAACGAGAGAGTTCTTGAAAGTTT
CTTCGGTTGGTACTACGCTTCTTCATCTGTTGCTGTCTTGATCGCTTTCACTGTCATTGTCTACATTCAAGATCATCTAG
GATGGAGGATAGGGTTTGGTATACCCGCGATTCTCATGCTACTCGCGAGTATAGTGTTTGCATTCGCATCTCCTCTCTAT
GTTAAACGTAATGTGACCAAGAGTCTGTTCACTGGTTTGGCTCAAGCGGCTGTTGCAGCTTACGTGAACAGGAAGTTAAT
GTTACCGGGTCAGAGTGACTCCTATGGTTGCTATCACCACTTGGAAGATTCTGAACTCAAAGCTCCAAGTGACAAATTGA
GGTTTTTGAACAAAGCTTGTGTCATAAGAAACCGCGACGAAGACATTGGTTCGGATGGTTTGGCCTTAAACCCATGGAGG
TTATGCACAACTGACCAAGTTGAGGAACTCAAGGCTTTGGTCAAGGTGATACCCGTATGGTCCACAGGGATAATGATGTC
TATAAACGTGAGCCAGAACTCGTTTCAGCTGCTTCAAGCTAACTCAATGGATAGACGTTTGAGCAACGATTCAACCTTCA
AAATCCCAGCTGGATCTTTTGGCATGTTCACAATCATAGCCCTAATCTCATGGGTGGTTCTCTACGACCGAGCCATCCTC
CCATTAGCTTCCAAGATCCGAGGTAGACCGGTTAGGATCAACGTCAAGATCCGAATGGGGTTAGGACTATTCATATCATT
CCTAGCAATGGCTGTTTCCGCAACTGTTGAGCATTACAGAAGGAGAACCGCGATAAGCCAAGGACTCGCAAACAACGCAA
CTGCTACAGTCAACATCTCAGCCATGTGGCTTGTACCGCAGTATGTCCTACACGGTTTAGCAGAGGCCTTAACCGGGATA
GGACAGACAGAGTTTTTCTACACCGAGTTTCCTAAAAGCATGTCGAGCATTGCAGCTGCGCTGTTTGGTCTAGGAATGGC
AGTGGCTAATATCTTGGCTAGTGTGATACTCAATGTGGTTAAGAATAGCTCAAAGAAAGGTGGAGTGAGCTGGATTGAAG
ATAATATCAACAAGGGTCATTACGATTACTACTATTGGGTTTTGGCGATCATGAGCTTCGTTAATGTTATTTATTACGTG
GCGTGTAGCTGGTCGTATGGTCCGACGGTGGATCAGGTGAGGAATGATAAGGTTAATGGGGTGAGAGAGGAGGAACAAGA
CGAAGTTGTTAAAATAAATTAA