Details for Kale Locus Bo5g126350

Position : C5 ( 5`- 38832341 .. 38836177 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126350

Protein [Map View]
MERVGMMNNSSNGQSLWHSSSQSPKTPTTMLDRALSSRRPHSDADLPDSGESGTDESKTKRPHVYLLASNFVSRIGHQWL
PCLIIALLFLVLLFLTSLAFHSSSFVCVSRFDPAARIGFFGFDGLESDFGALGVPWCRSKHGKEVEWTSKDLLKALEEFV
PIYETRPIKNNMHGMGFDHSFGLWFMARWLKPELMIESGAFKGHSTWVMRQAMPDTPIISLTPRHPEKYLKKGPAYVDGN
CTYFAGKDFVDFGSVDWKNVLKKHGVKDLNRVLVFFDDHQNELKRIKQALKAGFQHLIFEDNYDTGTGDHYSLRQICDQS
YIKGGGHSCFKDSDEARIRSNRKKFWEKAVDTEELCGPGETWWGVRGEMRDDFNHSNTQISYNQHFQNSRYVESILDVYW
ELPPVAGPSLTHQSRYDPARSTPPVVADGRRRLFQRIGLGRLDKSVFNGYTQMYWKILSSSVFMVVGTMAERWTNTALLV
IDMQNDFIEEGSVTQVKGGKAIVPNVIRVVELARQRGVLVVWDKRFLLSVLKVVREHDPQGRDVEIFRRHHYRSEKVGPV
VKGTLGSKLVDGLNIREEEDYKIVKTRFSAFFGTHLHSFLQTSGFTKLVIAGVQTPNCIRQTVFDAVELDYPDVTVIVDA
TAAATPEIHTANILDMRNIGVKTPTLHEWSEEFA*

DNA
ATGGAAAGAGTAGGGATGATGAACAACAGCAGCAACGGCCAATCACTGTGGCACTCCTCATCTCAGTCCCCCAAAACTCC
CACCACCATGCTCGATCGCGCCCTCTCCTCTCGCCGTCCTCACTCCGACGCCGATCTCCCCGACTCCGGCGAATCCGGCA
CCGACGAATCCAAGACCAAGCGCCCTCACGTCTACCTCCTCGCCTCCAATTTCGTCTCCCGGATCGGACACCAGTGGCTG
CCTTGCCTCATCATCGCTCTCCTCTTCCTCGTCCTCCTCTTCCTCACCTCCCTGGCTTTCCACTCTAGCAGCTTCGTCTG
CGTCTCCCGCTTCGATCCCGCCGCTCGGATCGGGTTCTTCGGTTTCGACGGGCTCGAATCGGATTTTGGAGCCCTAGGTG
TTCCTTGGTGCAGATCGAAACATGGAAAAGAAGTTGAGTGGACCTCCAAGGATTTACTCAAGGCTCTTGAAGAGTTTGTA
CCCATATACGAAACACGACCTATCAAGAACAATATGCATGGGATGGGTTTTGATCACAGCTTTGGGCTATGGTTCATGGC
GCGTTGGCTAAAGCCAGAGCTGATGATCGAGAGCGGCGCTTTTAAGGGGCATTCCACTTGGGTTATGCGGCAAGCGATGC
CAGATACACCGATTATCTCACTGACCCCAAGACACCCCGAGAAGTACTTGAAGAAGGGACCTGCCTATGTGGATGGAAAC
TGCACGTACTTTGCAGGCAAAGATTTTGTTGATTTTGGAAGTGTGGATTGGAAGAATGTGTTGAAGAAACACGGAGTAAA
AGATCTCAACCGTGTTCTTGTCTTCTTCGATGATCATCAGAATGAACTCAAAAGGATAAAGCAGGCACTGAAGGCAGGTT
TCCAACATCTCATATTCGAGGATAACTACGATACAGGAACCGGGGATCACTATTCTCTGAGACAGATATGTGATCAGTCA
TATATAAAAGGAGGTGGTCACAGCTGTTTCAAAGACAGCGATGAAGCCAGGATCAGATCAAACAGGAAGAAGTTCTGGGA
GAAAGCAGTTGATACAGAGGAACTCTGTGGACCAGGTGAAACATGGTGGGGAGTGCGAGGAGAAATGAGAGATGACTTTA
ACCACTCAAACACACAAATCTCATATAATCAGCATTTTCAGAACAGCCGATACGTTGAATCGATTCTTGATGTCTACTGG
GAGCTACCTCCGGTTGCAGGACCTTCATTGACACATCAATCGCGATACGACCCTGCTCGTTCGACTCCACCGGTGGTAGC
AGATGGGAGGCGCCGATTGTTCCAAAGAATCGGATTAGGTCGGCTGGATAAGTCTGTGTTCAATGGCTATACTCAAATGT
ACTGGAAAATCTTATCATCGTCTGTCTTTATGGTTGTGGGAACCATGGCAGAGAGATGGACGAACACGGCTCTACTAGTT
ATCGATATGCAGAATGATTTCATAGAAGAAGGTTCTGTGACGCAAGTGAAAGGCGGAAAAGCGATAGTTCCTAATGTTAT
CAGAGTGGTCGAACTCGCTAGGCAGCGTGGTGTTCTCGTGGTTTGGGACAAAAGGTTCTTGCTTTCAGTGTTGAAGGTTG
TTAGAGAACACGATCCTCAAGGACGAGATGTTGAGATTTTCAGGCGTCATCACTACCGTTCTGAGAAAGTTGGACCGGTT
GTTAAAGGAACCTTAGGTTCAAAGCTGGTGGATGGATTGAACATCAGAGAAGAAGAAGACTATAAGATAGTGAAGACCCG
TTTCAGCGCGTTCTTTGGCACACATCTCCATTCGTTCCTTCAAACTTCAGGGTTTACCAAGTTAGTCATCGCTGGTGTTC
AAACGCCAAATTGTATCAGGCAAACGGTATTTGATGCAGTGGAGCTGGATTATCCAGATGTAACTGTTATTGTAGATGCC
ACGGCTGCTGCAACACCAGAGATTCATACCGCGAATATTCTGGACATGAGGAACATCGGCGTCAAGACTCCTACGTTACA
CGAGTGGTCTGAAGAATTTGCATGA