Details for Kale Locus Bo5g126340

Position : C5 ( 5`- 38828500 .. 38829591 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126340

Protein [Map View]
MSEYLSEELAVEILARLTIKDLARFRCVCKTWRNIINSRGFTERHRDISPVKFVSFYDKGFYLLDMEDKHPVIETPRKLD
FPLDHQSMIDESTSVLHCDGTLCVTLNNHTLLVWNPSSKRFKIVPNPGIYRDSNILGLGYDPVSNDYKIVTFIDQLGSST
AHVFEFRTGSWRESVRILYPDWYYRERIGAFLDQSLYWIAYRSNVDRFILCFNLSTHEYRKLSLPVYNQGVTCSWLGVTS
QKLCITEYVSCEQKIWISVMEKTRSWNKIASLSMSNLISIQDHICDYQVEFVSFTKKNDIVVTFSGDCDNVEMEAEKRVK
IKVFLYKTGDNTFQQVRFCNSLAGFRFLSEYVESPVITDHIFI*

DNA
ATGTCGGAATATCTCTCCGAAGAACTAGCCGTCGAGATTCTCGCGAGGCTAACCATAAAGGATCTTGCTCGATTCAGATG
CGTCTGCAAGACATGGAGAAACATTATCAACAGCCGTGGCTTTACCGAAAGGCACCGTGACATTTCTCCGGTGAAGTTTG
TGTCGTTCTACGACAAGGGTTTCTACTTGCTTGACATGGAAGACAAGCATCCGGTTATAGAAACACCTCGTAAGCTTGAT
TTCCCTTTGGATCATCAGTCGATGATCGATGAATCCACATCTGTGCTTCATTGTGATGGGACGTTATGCGTGACCTTAAA
TAATCACACTTTATTGGTTTGGAATCCATCTTCAAAGCGTTTCAAGATCGTACCAAATCCCGGTATATATCGAGATTCAA
ATATCCTTGGTCTCGGTTACGATCCGGTTTCCAACGATTACAAAATCGTAACGTTTATCGACCAGCTTGGTTCTTCCACG
GCGCATGTTTTCGAGTTCAGAACCGGTTCTTGGAGAGAGAGCGTACGGATTCTTTATCCTGATTGGTATTACAGAGAGAG
AATTGGTGCATTCTTGGATCAGTCCCTCTATTGGATTGCGTACCGGTCTAATGTTGACCGGTTCATCCTATGCTTTAATC
TCTCGACCCATGAATACCGGAAATTATCTCTCCCGGTTTACAATCAAGGTGTCACGTGTTCTTGGTTAGGCGTTACAAGT
CAGAAACTTTGCATTACAGAGTATGTATCATGCGAACAGAAGATTTGGATTTCGGTTATGGAGAAAACCAGGTCATGGAA
CAAGATTGCAAGCCTTTCAATGTCGAATTTGATCTCTATACAAGACCATATCTGCGATTATCAAGTAGAGTTCGTGTCGT
TTACGAAAAAGAACGATATTGTCGTAACATTCAGTGGGGACTGCGATAATGTCGAGATGGAAGCTGAAAAACGTGTGAAG
ATAAAGGTGTTCTTATACAAAACCGGTGACAATACATTTCAACAAGTCCGGTTCTGTAACTCTTTAGCCGGGTTTAGGTT
TCTCAGTGAATATGTGGAGTCTCCTGTGATTACTGATCACATATTTATTTGA