Details for Kale Locus Bo5g126290

Position : C5 ( 5`- 38792922 .. 38795848 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126290

Protein [Map View]
MDTSRRAVESYWRSRMIDAVTSDEDKVAPVYKLEELCDLLRSSHVSIVKEFSDFILKRLDNKSPIVKQKALRLIKYAVGK
SGSEFRREMQRNSVAVRNLFHYKGYPDPLKGDALNKAVRDTAQETISAIFSEENGSKPAAPESINRRIEGFGNTNYQVPV
NDNKSFLSEVVGIGSASIKQGISSFAQGHLSNKNESGSSSYRGPNLHRSLTLENENSGRYDPVKLGSDGKYGVSKNTSGG
SWGHVSGEAASESSGSVRLESKTREEKLLETVVTSGGVRLQPTRDALHVFILEAAKMDTVALSIALEGKLQSPMWQVRMK
ALCVLEAILRKKEDGNFSIVHTYFSENTDVIQRCADSPQSSLREKANKVLSLLIGGQSKGFMSSSENTVKQETPVDLPDL
IDTGDSDYTTEDTLNMPNAINTGSTVTTAAPLMDDDWFGDSTDTGLISSEKKNDDDPFADVSFHPNEEKESADDLFSGMT
VGEKPTAVGGNQVPELFDMFGSTTALEAEPKDSKSINDLMGSFSIDETKSSQKGSSSNTLPENLFAMPSTTSHQTPENPL
GGILGSQSSGLIQNPMVPGGVMPFNFPPGMMMNPAFASQPLNYAAMASLLAQQQQYLGNISNFQQFGNMNAQGSGNVLPM
GTSGGSQSAFPDIFQPSFANQAPTSTMNGPKKEDTRAFDFISDHLSSARDTKRIS*

DNA
ATGGACACGAGCAGGAGAGCGGTGGAATCGTATTGGAGGTCGCGGATGATCGATGCGGTGACGTCTGACGAAGACAAGGT
GGCTCCTGTTTACAAATTGGAAGAGCTCTGCGACCTCCTTCGTTCTTCTCACGTCTCCATCGTCAAGGAGTTTTCCGACT
TCATTCTGAAACGTCTTGATAACAAGAGCCCCATCGTTAAGCAGAAGGCTCTTAGGCTGATAAAGTATGCTGTGGGGAAG
TCTGGCTCAGAGTTCAGAAGAGAGATGCAACGGAACTCTGTGGCGGTTCGCAATCTATTTCATTACAAGGGGTATCCAGA
TCCTTTAAAAGGGGATGCGCTTAATAAGGCTGTACGAGATACTGCTCAGGAGACAATCTCTGCTATATTCTCGGAAGAGA
ATGGTAGTAAGCCAGCTGCTCCGGAAAGCATCAACAGACGCATAGAAGGATTCGGGAATACTAACTATCAGGTGCCGGTT
AATGATAATAAGTCGTTCCTGAGTGAGGTGGTTGGTATTGGAAGTGCATCGATAAAGCAAGGAATCAGTAGTTTTGCCCA
AGGTCATTTGTCTAATAAGAATGAGAGTGGAAGCAGCAGCTACAGAGGTCCGAATCTCCACAGATCTTTAACTTTGGAAA
ATGAGAACTCGGGTAGATATGATCCGGTTAAGCTGGGGAGTGATGGTAAATATGGGGTGTCGAAGAACACCAGTGGTGGA
TCTTGGGGGCACGTTTCTGGAGAGGCCGCAAGTGAAAGTTCGGGTTCAGTTCGTCTTGAGAGCAAAACCCGTGAGGAAAA
GCTGCTGGAAACAGTTGTTACATCTGGTGGTGTACGCCTGCAGCCAACTCGGGATGCACTTCATGTATTCATCTTAGAGG
CTGCGAAAATGGATACTGTCGCTTTAAGCATTGCTCTTGAGGGGAAGCTCCAGTCTCCAATGTGGCAGGTTCGAATGAAA
GCTTTATGTGTCCTTGAGGCCATTTTGAGGAAGAAGGAAGATGGTAATTTTTCAATTGTACACACTTATTTTAGTGAAAA
CACAGATGTCATACAACGATGCGCAGATTCTCCTCAGTCTTCTCTTCGGGAGAAGGCTAACAAGGTTCTGAGCCTTCTAA
TTGGTGGTCAGTCAAAGGGTTTTATGAGCAGCTCAGAGAATACTGTGAAGCAAGAGACTCCTGTTGATTTACCTGACTTG
ATTGATACAGGTGATTCAGATTATACAACAGAAGATACATTGAACATGCCAAATGCTATAAATACTGGTAGTACAGTGAC
TACAGCAGCTCCATTGATGGATGACGATTGGTTTGGGGATAGCACTGACACTGGATTGATTAGCAGTGAGAAGAAAAATG
ATGATGACCCTTTTGCAGATGTATCATTTCATCCTAATGAAGAAAAAGAAAGTGCAGATGACCTCTTCTCTGGAATGACT
GTTGGGGAAAAGCCAACTGCTGTAGGTGGTAATCAAGTGCCTGAGCTATTTGACATGTTTGGTTCAACTACAGCACTTGA
AGCAGAGCCCAAAGATTCTAAAAGCATAAATGATCTAATGGGAAGCTTCTCCATTGACGAAACCAAATCAAGTCAGAAAG
GCTCGTCATCAAACACCCTTCCAGAGAATTTATTTGCAATGCCGAGCACCACCAGCCACCAAACACCGGAAAATCCTCTT
GGAGGCATTCTTGGCTCACAAAGTTCTGGGTTAATTCAAAACCCAATGGTTCCTGGAGGTGTCATGCCCTTTAATTTCCC
TCCTGGGATGATGATGAATCCAGCCTTTGCGTCTCAACCTTTGAATTACGCTGCCATGGCAAGCTTGCTAGCTCAGCAGC
AGCAGTACCTTGGTAATATATCCAACTTCCAGCAGTTTGGCAACATGAACGCTCAGGGCAGTGGAAATGTTCTCCCTATG
GGTACTAGCGGAGGAAGTCAGTCAGCATTCCCTGATATATTCCAGCCAAGTTTTGCTAATCAAGCTCCAACCTCAACAAT
GAATGGTCCGAAAAAAGAAGATACCAGAGCATTTGACTTCATCTCCGATCATCTTTCATCTGCCCGCGACACAAAGAGAA
TATCTTGA