Details for Kale Locus Bo5g126280

Position : C5 ( 5`- 38789859 .. 38790581 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126280

Protein [Map View]
MTSSNSSSSPTSSSSDQSDVTTTTSTHLSETSPRNNKRKRSNDSSSSSSKLKHPVYRGVRMRSWGKWVSEIRQPRKKTRI
WLGTFATADMAARAHDVAALAIKGSSAVINFPELASVLPRPASSSPHDIQAAAAEAAAMVVNGKLSESAKTEMKEAPPSP
ESSYVAAESKEEERLEEIVELPNIEEGSYDMSVKSHSDLDYSEPLDCWVYPPPVMDLYEEFLEFDFLELWSFPHTELINP
*

DNA
ATGACGTCATCCAACAGTTCTTCATCACCAACATCATCGTCTTCGGACCAATCTGATGTAACTACAACAACAAGCACCCA
CTTGTCCGAAACTTCACCGAGAAACAACAAAAGAAAGAGAAGCAACGATTCTTCTTCATCTTCTTCAAAGCTTAAGCATC
CTGTTTACAGAGGTGTACGGATGAGAAGCTGGGGCAAATGGGTCTCCGAGATCCGACAGCCTCGTAAAAAGACTAGAATC
TGGCTCGGTACATTCGCCACCGCAGACATGGCGGCGCGTGCTCACGACGTCGCTGCTCTCGCCATCAAAGGCTCCTCCGC
CGTCATCAACTTCCCGGAGCTTGCCTCTGTCCTCCCTCGTCCGGCGTCATCTTCGCCGCATGATATCCAAGCAGCAGCTG
CGGAAGCCGCCGCCATGGTGGTCAACGGAAAATTGTCAGAGTCTGCTAAAACAGAGATGAAGGAAGCACCACCGTCGCCG
GAATCTTCTTACGTGGCGGCGGAGTCTAAGGAGGAGGAGAGGTTGGAGGAGATTGTGGAGTTGCCTAACATTGAAGAGGG
GAGTTATGACATGAGCGTGAAGTCACACTCTGACCTGGATTATTCTGAGCCGTTGGATTGTTGGGTGTATCCTCCTCCGG
TTATGGATCTCTATGAAGAGTTCTTGGAGTTCGATTTCTTGGAGTTATGGAGCTTTCCTCACACGGAACTGATTAATCCT
TAA