Details for Kale Locus Bo5g126240

Position : C5 ( 5`- 38759861 .. 38763731 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126240

Protein [Map View]
MDVRLSRSSKSRAAKGIFKSLNLLTRRACQVSLCSNPRAELSFSGIPRSENSNTAVCILSVNLTAFSVANFRSFRSASSI
SALVASLYSVICISRFIYSASKVSFSLEIVKEDSVLLVIMSAHRTPKTGRQSLLFQDLASPVSARRGKFSTPGQAAAVSA
LWRENLGGSDLPPPPMYTLDDRSDFSPESGIADYSASPDVKSERRTPFLSSGKNVVTPGKGKLEASPSFSLLSGQQQSQQ
VSGSPSWWSQSKGGGSSAEQDDKGKGSPVEGVVQPGALVTLPPPREVARPEVQRQVIPTGNVQEEEWVTVYGFSPSDTNL
VLREFEKCGMIVKHVPGPRNANWMHILYQNRSDAQKALSKTGMMINGVVIVGVKPVDPIQRQALNERLNNQGFMPLPPPS
STRDSEFNAARGASSRPNYLQNGSAFSPQPNGGAMAVPSKSMVSNGQDSCLVQSDHHWVYLKDTDYMESEKPHGVTGNAM
AKATEQKQDSQTVEVTKLDIRYVITTATTYGGRRNDVAMFVLRAMCMAVSAVAVSLMVTARETSMTTLYGFEFQLHAVWS
LSDSLIYLVAVSSATVIYSLLQLILSGTRLMRKSPVIPTRTQAWFCFAADQILGYAMVSGGSAALGVTNMNRTGIRHMPL
PNFCKSLGFFCDHLAISVVFALLAFLLLAASSILDVLHLSRS*

DNA
ATGGATGTGAGATTGTCGCGTAGCAGCAAATCGCGCGCCGCTAAGGGAATTTTCAAAAGCCTTAACCTTCTCACGCGGAG
AGCGTGCCAAGTCTCGTTGTGTAGCAATCCTCGAGCTGAGCTGAGCTTCTCCGGGATTCCCAGATCGGAAAACTCGAACA
CCGCCGTCTGCATCCTCAGCGTGAATCTCACTGCCTTCTCGGTCGCTAACTTTAGATCATTTCGTTCAGCTTCTTCGATT
TCTGCTCTAGTAGCAAGCTTATATTCAGTGATCTGCATTTCTAGATTCATCTATTCTGCGAGTAAGGTTAGCTTTAGTTT
GGAGATAGTTAAAGAAGACTCTGTTCTACTAGTCATCATGAGTGCTCACAGGACTCCTAAAACAGGGAGGCAATCTCTCC
TCTTTCAAGATTTAGCTTCTCCTGTTTCCGCGCGCCGTGGAAAGTTCTCAACCCCTGGCCAAGCAGCTGCTGTATCTGCA
CTATGGCGTGAGAATCTCGGAGGCTCCGATCTTCCACCTCCGCCAATGTATACTCTCGATGACCGTTCTGATTTCTCTCC
CGAGTCTGGCATTGCAGACTACTCCGCGTCTCCTGATGTCAAATCCGAGAGGCGGACGCCTTTCCTGAGCTCTGGGAAGA
ACGTTGTGACTCCCGGTAAAGGGAAGTTGGAAGCGAGTCCTTCTTTTTCTTTGCTGAGTGGGCAGCAGCAGAGTCAGCAG
GTTTCCGGGAGTCCGAGTTGGTGGTCGCAGTCGAAGGGAGGTGGGAGTAGTGCCGAGCAGGACGATAAAGGGAAGGGGTC
TCCTGTTGAAGGAGTGGTTCAGCCAGGTGCTTTGGTTACTCTTCCGCCACCGAGGGAAGTTGCTAGGCCTGAGGTTCAGA
GGCAGGTTATACCCACAGGGAATGTTCAGGAGGAAGAGTGGGTCACTGTCTATGGGTTTTCTCCAAGTGATACAAATTTG
GTACTAAGAGAGTTTGAAAAGTGTGGTATGATCGTGAAACATGTTCCTGGTCCAAGGAATGCCAACTGGATGCACATTCT
CTACCAGAACCGGTCTGATGCACAGAAGGCCCTGAGCAAAACCGGGATGATGATCAACGGAGTGGTAATAGTAGGAGTAA
AGCCAGTAGACCCGATACAGAGGCAAGCGTTAAACGAAAGACTGAACAACCAAGGATTCATGCCTTTACCTCCACCATCA
TCCACCAGAGACTCTGAGTTCAACGCAGCTAGGGGGGCCTCTTCTCGTCCGAACTACTTGCAAAACGGAAGCGCTTTCTC
CCCTCAACCAAATGGCGGCGCCATGGCCGTTCCATCAAAGTCGATGGTCTCAAATGGTCAAGACTCATGCCTCGTGCAGA
GCGACCACCACTGGGTATACTTGAAAGACACTGATTACATGGAATCTGAGAAGCCTCACGGAGTCACGGGCAACGCAATG
GCGAAAGCAACAGAACAGAAACAAGACTCTCAAACCGTGGAAGTAACGAAGCTTGATATCCGCTATGTGATCACCACAGC
CACCACATACGGCGGCAGACGCAATGACGTGGCAATGTTTGTGTTACGAGCCATGTGCATGGCTGTATCTGCGGTGGCTG
TGTCGTTAATGGTGACAGCCCGTGAGACTAGCATGACAACTCTCTACGGTTTCGAGTTTCAGCTCCACGCCGTCTGGTCT
CTCTCAGATTCCCTCATTTATCTAGTGGCGGTTTCATCAGCAACGGTTATTTACTCATTGCTGCAACTGATTTTGAGCGG
GACCAGACTAATGAGAAAATCTCCGGTGATTCCGACAAGAACACAAGCATGGTTTTGCTTCGCTGCGGATCAGATATTGG
GATACGCGATGGTGAGTGGAGGATCAGCGGCTTTGGGAGTGACGAATATGAACAGAACAGGAATCAGGCACATGCCTCTT
CCCAATTTCTGCAAATCTCTAGGTTTCTTCTGTGACCATCTAGCAATCTCCGTCGTCTTCGCCTTGCTCGCGTTCCTCCT
CCTCGCCGCTTCTTCTATTCTCGACGTTCTCCATCTCTCCCGCAGCTGA