Details for Kale Locus Bo5g126230

Position : C5 ( 5`- 38755490 .. 38759787 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126230

Protein [Map View]
METLLANCVEKNLTQFMFSNAIFLCERLLAQFPSEVNLQLLARCYLSNSQPYSAYYILKGSKTPQSRYLFAFSCFKLDLL
GEAESALLSTEESVEKVPGGAAGHYLLGLIYRYAGRKISSIQQFRMALSCDPLCWEAYAELCSLGAAEDASMVFGNVAAQ
RLQKTNVSQRINFSEGETRDHLIDSDKVSKDTSVWQTEHVSGENQQDLKAKQLGAEIPPDSDKQCNGSSHTNGWDLKTPS
PVLTQVLDAPPPMLYKNMRRPEVEGLMSVHGESRRKFMSEEESLEAPEESGRRRSARIAARRKIPLFHSYGKDSHVLHHS
PSESNGVPSLSSMIGKCRIQSSKEATTSGQSIGDTGSSVDDEQNSNPRGSSPDPFSLMSGVSEVLNLLKILGNGHRHLLM
YNCQEALLIYQKLSEKQYNTHWVLMQVGKAYVELQDYFNADSVFTLAHQKSPYALEGMDTYSTVLYHLKEEMRLGYLAQE
LIAVDRLSPESWCASGNYYSLRKDHEAALKMFRRAIQLNDRFTYAHTLCGHELAALEDFEEAERCYRKALSIDTRHYNAW
YGLGMTYLHQEKFEFAQHQFQLALQINPRSSVIMCYFGIALHESKRNDEALKMMEKAIVADARNPLSKYFKANILADLGD
YHRALEVLEELRDSAPHESSVHALLGKIYKEVKLYDKAVLNFGTALDLDPSPSDTVKIKAFMERLAVPNELETEEDL*

DNA
ATGGAGACTTTACTGGCGAATTGTGTGGAGAAAAACCTTACCCAGTTTATGTTCTCCAATGCGATCTTCCTCTGCGAACG
TCTTCTCGCCCAATTCCCCTCTGAGGTGAACCTGCAATTGTTAGCTAGGTGTTACTTAAGTAACAGTCAACCTTATAGTG
CTTATTACATCCTCAAAGGTTCAAAAACGCCTCAGTCTCGGTATCTGTTTGCATTCTCATGCTTTAAGTTGGATCTTCTT
GGAGAGGCTGAATCAGCATTGTTGTCAACTGAGGAATCTGTTGAAAAAGTTCCTGGTGGTGCAGCTGGGCATTATCTTCT
TGGTCTTATCTATAGATATGCTGGGAGGAAGATTAGTTCGATACAACAGTTTAGGATGGCATTGTCTTGTGATCCATTGT
GTTGGGAAGCATATGCAGAACTTTGTAGTTTAGGTGCTGCTGAAGATGCCTCAATGGTTTTTGGCAATGTCGCTGCCCAG
CGTCTTCAGAAAACTAACGTCTCACAGAGAATAAACTTCTCAGAAGGAGAAACCAGGGACCATCTTATAGATTCCGATAA
GGTCTCAAAAGATACCAGTGTATGGCAAACAGAACATGTTTCAGGAGAGAACCAACAAGATCTGAAAGCCAAGCAGCTTG
GAGCAGAGATTCCGCCAGATAGTGACAAGCAATGTAACGGTAGTTCTCATACAAATGGATGGGACCTGAAAACACCTTCT
CCAGTGCTTACACAGGTATTGGATGCTCCACCGCCAATGCTCTATAAGAATATGCGTCGTCCAGAAGTGGAAGGATTGAT
GTCTGTACATGGAGAGTCTCGAAGAAAGTTTATGAGTGAAGAAGAGTCATTAGAGGCTCCAGAAGAATCTGGGCGTCGCC
GGAGTGCCAGAATAGCAGCAAGGAGAAAGATTCCTCTGTTTCACTCATATGGAAAAGATTCCCATGTGTTACATCATTCA
CCTTCCGAGTCAAACGGTGTACCTTCTCTTTCCTCGATGATTGGAAAATGCAGAATCCAAAGCAGTAAGGAAGCAACGAC
ATCAGGCCAGTCTATAGGCGACACTGGAAGCTCTGTTGATGATGAGCAAAACTCAAATCCTCGTGGATCTTCCCCGGATC
CTTTCAGTCTCATGTCTGGAGTTTCAGAAGTGCTAAACCTTCTGAAAATTCTTGGAAATGGCCACAGGCATTTACTTATG
TACAACTGTCAGGAAGCTTTGTTGATATATCAAAAGCTATCTGAGAAACAATACAATACACACTGGGTTCTCATGCAGGT
TGGAAAAGCATATGTTGAGCTACAAGACTACTTCAACGCTGACTCTGTCTTTACTCTCGCTCATCAAAAATCTCCTTATG
CTTTGGAAGGAATGGATACGTACTCCACTGTTCTTTATCACCTGAAAGAAGAGATGAGGCTGGGCTATCTGGCTCAGGAG
CTGATTGCAGTCGACCGCCTATCTCCAGAATCATGGTGTGCGTCAGGGAACTACTACAGTTTGCGCAAAGATCACGAAGC
TGCTCTTAAGATGTTTCGGAGAGCTATCCAACTGAATGATAGATTCACATATGCACATACCCTTTGCGGTCACGAGCTTG
CTGCATTAGAAGACTTTGAGGAGGCAGAGAGATGCTACCGGAAGGCACTGAGCATAGACACAAGACACTACAATGCATGG
TATGGTCTTGGAATGACCTACCTTCATCAGGAGAAATTCGAGTTTGCGCAGCATCAATTTCAACTGGCTCTCCAAATAAA
CCCAAGATCTTCAGTCATCATGTGTTACTTTGGAATTGCGTTGCATGAGTCAAAGAGGAACGATGAGGCGTTGAAGATGA
TGGAGAAGGCTATAGTTGCTGATGCTAGGAATCCACTCTCGAAGTACTTTAAGGCTAACATATTGGCCGACCTCGGTGAT
TATCACAGAGCCCTGGAAGTTTTGGAAGAGCTCAGAGATTCTGCTCCTCATGAGAGCAGTGTCCATGCGTTGCTTGGCAA
AATCTACAAAGAAGTCAAGCTATACGACAAGGCCGTGTTAAATTTCGGCACTGCGTTGGATTTAGACCCATCTCCATCTG
ATACTGTCAAGATCAAGGCTTTCATGGAGAGGTTGGCAGTACCAAACGAGTTGGAGACCGAGGAGGATCTCTAG