Details for Kale Locus Bo5g126220

Position : C5 ( 5`- 38753637 .. 38754260 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126220

Protein [Map View]
MEKSVPISKKLWNLVRFVMYMLHKGISKQKLLAEFNATLKRGKNLMFNNRRRVPATASTVSSQPQKEYEFSCSDTPNYSF
PFSMAAFKKKSHHIGLFACGQAPPTLDDDTSASLAVLELLNGVGVQEGGSKTPALSVEALMALSPYNLPRFGRSSPSVRP
LRVTDSPFPLTEDGDVANGHVDKAAEEFIMKFYKNLNQQKKIEFSPN*

DNA
ATGGAGAAGAGCGTACCAATAAGCAAGAAGCTATGGAACCTCGTACGTTTTGTCATGTACATGTTACACAAAGGCATCTC
AAAGCAAAAGCTCCTGGCTGAATTTAACGCCACTCTCAAACGCGGCAAGAATCTCATGTTCAACAACCGCCGCCGCGTCC
CAGCCACCGCCTCCACCGTCTCGTCCCAGCCGCAGAAAGAATACGAGTTTAGCTGCAGCGACACTCCAAACTACTCGTTC
CCCTTTAGCATGGCCGCTTTCAAGAAGAAGAGTCACCACATTGGTCTCTTCGCCTGTGGTCAAGCGCCACCGACTCTCGA
CGACGATACCTCCGCCTCCTTAGCCGTGCTGGAGCTTCTCAACGGCGTCGGAGTTCAAGAAGGCGGTAGTAAGACGCCGG
CTTTGTCGGTCGAGGCTTTGATGGCGTTGTCTCCTTATAACTTGCCCCGGTTTGGACGGAGTTCTCCGTCAGTGAGACCT
TTACGTGTGACGGACTCACCGTTCCCGTTAACGGAAGATGGTGACGTGGCTAACGGACATGTGGACAAAGCAGCCGAGGA
GTTTATAATGAAGTTTTACAAGAACTTGAATCAGCAAAAAAAGATTGAGTTCTCACCTAATTAA