Details for Kale Locus Bo5g126180

Position : C5 ( 5`- 38706656 .. 38708472 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126180

Protein [Map View]
MTRRCSHCSYNGHNSRTCPTRGGGGGGGGTCGGNGGGSASSSSSAAVKLFGVRLTDGSIIKKSASMGNLSALAVHHRLSP
LATGNHNDSPFSDHGRYSSQENGGYLSDDPGHGSGSIHHRRVERKRGVPWTEEEHRLFLVGLQKLGKGDWRGISRNYVTS
RTPTQVASHAQKYFIRHTCSTRRKRRSSLFDMVTDEMVTDPSPTQEDQTLIKEPENKTYLPSLELKLNNATESEVVPPVE
QPEEVIEPPNAISPMLVPGSFFPPCFPVTYTIWLPATSSSLQGTDHTLEVSASSQQHQVLKPKPGFAKERANMDELVGLS
QLSIGMETSHETETPMSLKLIGEPSRPSAFHSNGSVSGSGLSKGSSAIQAT*

DNA
ATGACTCGTCGGTGTTCGCATTGTAGCTACAATGGGCATAACTCCCGCACGTGCCCGACTCGTGGGGGTGGTGGTGGTGG
TGGCGGCACGTGCGGTGGAAACGGAGGAGGATCTGCTTCTTCCTCCTCCTCTGCTGCCGTGAAGCTGTTCGGCGTGAGGT
TAACGGATGGGTCGATTATCAAGAAGAGTGCGAGTATGGGTAACCTCTCTGCATTGGCCGTGCACCACCGTTTGTCTCCT
TTGGCGACGGGTAATCATAACGACTCGCCGTTTTCGGATCATGGGAGGTACTCTAGTCAAGAGAACGGAGGGTATTTGTC
GGATGATCCAGGTCATGGTTCTGGGTCTATCCACCACCGTCGTGTGGAGAGGAAGAGAGGCGTTCCTTGGACGGAGGAGG
AGCACAGGCTATTCTTAGTGGGTCTTCAGAAGCTAGGAAAAGGAGATTGGCGTGGTATTTCAAGAAATTATGTAACTTCA
AGAACTCCAACACAAGTGGCTAGTCATGCTCAAAAGTATTTCATCCGCCATACTTGTTCCACCCGCAGGAAAAGACGTTC
TAGCCTCTTCGACATGGTTACCGATGAAATGGTAACCGATCCATCGCCAACGCAGGAAGACCAAACCTTAATCAAGGAGC
CTGAAAACAAAACCTACCTTCCTTCACTTGAGCTCAAACTCAACAATGCTACAGAATCTGAAGTGGTGCCACCAGTGGAG
CAACCTGAGGAAGTCATAGAGCCACCAAACGCTATTTCACCAATGCTAGTCCCAGGCAGCTTCTTTCCTCCTTGCTTTCC
AGTCACTTACACGATTTGGCTCCCTGCGACTTCCTCTTCACTTCAAGGAACAGATCACACCTTAGAAGTCTCAGCTTCTT
CTCAGCAGCATCAGGTCCTAAAACCAAAACCTGGTTTTGCTAAAGAACGGGCCAACATGGACGAGCTGGTCGGTCTGTCT
CAGCTTAGCATAGGAATGGAGACAAGTCATGAAACCGAGACTCCCATGTCTCTGAAACTAATAGGAGAGCCGTCAAGGCC
ATCTGCGTTTCACTCGAATGGCTCAGTTAGTGGCTCGGGTTTGAGCAAAGGCAGCAGCGCGATTCAGGCGACCTGA