Details for Kale Locus Bo5g126170

Position : C5 ( 5`- 38680299 .. 38681442 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126170

Protein [Map View]
MQRQVALIKQSLFDQGYLDEQFMELEELQDDVNPNFVEEVATLYFKDSARLINSIDQALERGSFDFNRLDNYMHQFKGSS
TSIGASKVKTECTMFREYCRMGNAEGCLRTFQQVKKEHATLRKKLEHYFQLARQAGPKETARRSK*

DNA
ATGCAGAGGCAAGTGGCACTCATTAAGCAGTCCCTCTTTGATCAGGGATATCTCGACGAACAGTTCATGGAGTTAGAAGA
GCTCCAAGATGATGTAAACCCTAATTTTGTTGAAGAAGTTGCCACATTATACTTCAAAGATTCAGCTAGGTTAATCAATA
GCATTGACCAAGCTCTGGAAAGAGGATCATTTGATTTCAATCGGCTGGATAACTACATGCATCAGTTTAAGGGCAGCAGC
ACCAGCATTGGTGCGAGTAAGGTGAAAACTGAATGCACTATGTTTAGGGAATACTGCAGAATGGGAAACGCCGAAGGATG
CTTGAGGACTTTCCAGCAAGTGAAAAAAGAGCACGCAACGTTGAGAAAGAAGCTTGAACATTATTTCCAGTTGGCAAGAC
AGGCGGGACCTAAGGAGACAGCACGTAGGTCCAAGTAA