Details for Kale Locus Bo5g126150

Position : C5 ( 5`- 38668875 .. 38671221 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g126150

Protein [Map View]
MAAIVKTEMQPVGNSQSSSLASLYVGDLSPDVTEADLTAKFSLTVPVVSAHLCRDSVTGKSLRYAYVNFDSAITASNAMA
CLNHTDLKGKTMRIMWSQKDVAYRRRSGLGNLFVKNLDSSITSSCLERMFSPFGVILSCKVAEENGQSKGFGFVQFATEQ
SAVAARLASHGSMVDGKKLFVAKFINRDERAAMSGNQEFTNVYVKNLLESVTEDFLHTMFSQCGTVSSVVVMRDGMGRSR
GFGFVNFCHPENAKKAVETLNGQPHGSKKLFAGRALRKAERMEMLKQKHKDNFVAKFNVGWFNLYVKNLTESMGETKLRE
IFGSYGKIVSAKVMRDENGKSKGFGFVAFSTLDESKHAKRELHGFIVDGQSLVVRVAERKEDRFKRMQKYHPVQSRHYMQ
AAPVPSPAQPVPPSMEYKQYYGVQPRNYTQALPVPSPAQPVPPPSMSSSPYGYLQPFHIGAYYYPMATQLPQMSGHQNLT
TYVPAGQAHLKEKRSVQLVYKRPGYTTFVKSGAKQKLVFKGQGDKNLEAGTCSTKAKTSAEKRKEVSSHLMAMLTPNRNA
AQNLATLEVA*

DNA
ATGGCGGCGATCGTGAAAACGGAAATGCAACCCGTAGGAAACAGCCAGTCCTCGAGCCTCGCTTCGCTTTACGTCGGCGA
TCTTAGCCCCGACGTGACGGAGGCTGATCTCACCGCCAAATTCTCCTTGACTGTCCCCGTCGTCTCCGCTCATCTCTGCC
GCGACTCCGTCACCGGAAAATCACTGCGTTACGCTTACGTCAACTTCGACTCAGCCATCACCGCGTCGAACGCTATGGCG
TGCTTGAACCACACCGATTTGAAGGGGAAGACGATGCGGATAATGTGGTCTCAGAAAGATGTTGCGTACCGTCGTCGTAG
TGGATTGGGGAATCTCTTCGTTAAGAATCTTGACAGCTCCATCACTAGCAGTTGCTTAGAGCGGATGTTTAGTCCCTTCG
GAGTCATACTTTCTTGCAAAGTCGCTGAGGAGAATGGCCAAAGTAAAGGCTTCGGTTTTGTTCAGTTTGCTACGGAGCAA
TCTGCTGTTGCTGCTCGTCTTGCCTCCCACGGATCTATGGTTGATGGCAAGAAACTGTTTGTGGCTAAGTTCATTAACAG
GGATGAAAGAGCTGCTATGTCTGGGAATCAAGAGTTCACAAACGTTTATGTGAAGAATCTGCTCGAGAGTGTTACAGAGG
ATTTTCTCCATACCATGTTTTCTCAATGTGGGACGGTCTCTAGTGTTGTGGTTATGAGGGATGGTATGGGAAGATCCAGA
GGTTTCGGATTTGTCAACTTCTGCCATCCAGAGAATGCAAAGAAAGCTGTGGAAACTCTCAATGGACAACCACATGGTTC
GAAGAAGTTGTTTGCTGGAAGGGCTTTGAGAAAAGCTGAAAGGATGGAGATGCTGAAACAGAAACACAAAGACAACTTTG
TTGCCAAGTTCAATGTTGGTTGGTTTAATCTGTACGTGAAGAACTTGACCGAATCAATGGGCGAAACAAAGCTGCGAGAG
ATATTTGGAAGCTATGGGAAGATAGTTTCAGCAAAAGTGATGCGTGATGAAAATGGCAAAAGTAAAGGATTCGGCTTTGT
GGCTTTCTCTACCCTTGACGAGTCCAAACATGCTAAAAGAGAGCTCCACGGATTTATAGTGGATGGACAGTCACTTGTTG
TTCGAGTTGCTGAACGTAAGGAGGATCGCTTCAAGAGGATGCAGAAATATCATCCAGTACAATCTCGCCATTACATGCAA
GCTGCTCCTGTCCCTTCACCAGCTCAGCCGGTCCCGCCATCTATGGAGTACAAGCAATATTATGGAGTGCAGCCACGCAA
TTACACGCAAGCTCTTCCTGTGCCTTCACCAGCTCAGCCAGTCCCACCACCGTCTATGAGCAGCAGCCCATATGGTTACT
TGCAGCCATTCCATATTGGAGCATACTATTACCCTATGGCCACTCAGTTACCACAGATGTCGGGTCACCAAAACTTGACC
ACCTACGTTCCCGCTGGCCAAGCTCATCTGAAGGAGAAAAGATCAGTTCAACTAGTCTACAAACGCCCGGGTTACACCAC
CTTTGTCAAGAGTGGTGCTAAACAGAAACTGGTCTTTAAGGGGCAAGGTGACAAAAATTTAGAGGCAGGCACTTGCTCCA
CCAAAGCGAAGACATCTGCTGAAAAACGTAAAGAAGTATCATCGCATTTGATGGCAATGTTGACACCAAATAGGAATGCT
GCACAGAATTTAGCAACACTTGAAGTTGCTTAG