Details for Kale Locus Bo5g125010

Position : C5 ( 5`- 38444657 .. 38447043 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g125010

Protein [Map View]
MSWDDGKHAKVNKVQITYDDVIYSIQVTYAGTALQSQRRGSVGPKTAEFTLGPDEYITALTAYGKTLSTQDVITSLTFKT
NKGTYGPYGNKTGYQISAPEGTGKQIAGFLGTSGNVLNSIDVHYAPIPTGTGTGGTGAGGTGTGGTGTGTGGTGTGGTGT
GGTGTGGTGTGGTGTGGTGTGGTGTGGTGTGGTGTGTGGTGTGGSGTGSGVEKLDAQGGTGGTAWDDGSDHDGVTKITVR
TGGAGVQYVQFGYVKAGQPKQGALGGVQGSRGSTKEILINHPDEHLISVEGWYDSSNIIIGIQFKTNQKTSDYMGYDFDG
SGTKFTLQVQGKKIIGFHGFASDHLNSIGAYFVPVSSTPTTPTVPPKKLEAKGGASGAVWDDGAHDNVKKVSVGQGTDGI
AAVKFEYRNGLSVVIGAERGTPTLLGYEEFELASDEYITIVEGYYDKILGSDGLTSLTFHTNKGTYGPYGLEGSTHFEFK
EDGHKITGFHGRAGDTLTAIGVYLAPVGTIPLTPATQTKKLEAKGGDGGTTWDDGAFDGIRKVSVGQTYDGIGAVKFVYN
KGSSEIIGDEHGKSTLLGFEEFELNYPSEYITEVHGTYDKISASNSAIVNMLTFKTNKPATYGPFGLNAGTPFDLKEEGH
KIVGFHGSSGDLLHKFGVHVLPIN*

DNA
ATGTCTTGGGACGATGGTAAGCACGCAAAGGTGAACAAAGTTCAGATTACTTACGATGACGTCATCTACTCAATCCAGGT
CACGTACGCCGGAACCGCTCTTCAATCTCAGCGTCGTGGCTCCGTTGGGCCCAAAACTGCCGAGTTCACTTTGGGTCCGG
ACGAGTACATAACGGCTCTGACTGCTTACGGCAAAACGCTGAGCACGCAAGACGTTATAACGTCGTTGACTTTCAAAACG
AACAAGGGAACTTATGGTCCCTACGGAAACAAAACTGGTTACCAGATTTCTGCTCCAGAGGGTACCGGTAAACAGATCGC
CGGTTTCCTTGGTACTAGCGGCAATGTTCTCAACTCCATAGACGTTCACTACGCTCCCATACCCACTGGAACCGGAACCG
GAGGAACAGGTGCGGGAGGAACCGGAACCGGCGGGACTGGAACCGGTACAGGAGGAACCGGAACCGGAGGAACTGGTACG
GGCGGAACCGGAACCGGAGGAACCGGAACAGGTGGAACCGGAACCGGTGGAACTGGAACTGGGGGAACCGGAACCGGTGG
TACTGGCACGGGAGGAACAGGAACTGGCACGGGAGGAACCGGAACCGGCGGATCAGGGACCGGTTCAGGGGTTGAAAAGT
TGGATGCACAAGGTGGTACAGGAGGAACCGCATGGGACGACGGATCCGATCACGATGGCGTGACAAAGATAACCGTAAGA
ACCGGTGGGGCAGGCGTTCAATACGTTCAGTTCGGTTATGTGAAAGCCGGACAACCGAAACAAGGAGCCCTCGGCGGTGT
GCAAGGTAGTAGAGGTTCAACAAAAGAGATTTTGATTAACCACCCGGACGAGCATCTAATTTCCGTGGAGGGTTGGTATG
ATTCCTCCAATATAATCATAGGAATCCAGTTCAAGACTAATCAAAAGACGTCTGATTACATGGGCTATGATTTCGATGGT
AGTGGTACTAAGTTTACTCTCCAAGTTCAAGGCAAGAAGATCATTGGGTTTCACGGTTTCGCCAGCGACCATCTCAATTC
CATTGGAGCGTATTTCGTTCCCGTGTCCTCCACCCCCACCACTCCTACTGTTCCACCGAAGAAGCTTGAAGCTAAGGGTG
GTGCGTCTGGAGCTGTGTGGGACGATGGTGCTCACGACAATGTTAAAAAGGTCTCTGTTGGACAAGGCACAGATGGTATA
GCAGCTGTCAAGTTTGAATACAGAAATGGTTTGTCGGTTGTTATTGGAGCTGAACGTGGGACACCAACATTGCTTGGATA
CGAAGAGTTTGAGCTTGCATCTGATGAATACATAACCATCGTGGAAGGCTACTACGACAAAATCTTAGGAAGTGATGGCC
TGACGAGTCTCACTTTCCATACTAACAAGGGTACATATGGTCCGTATGGTCTCGAAGGTAGCACACACTTTGAATTCAAG
GAGGACGGTCACAAGATTACAGGGTTCCATGGACGAGCTGGTGATACTCTCACTGCTATTGGAGTTTACTTAGCTCCAGT
AGGCACCATCCCCTTGACTCCTGCAACACAAACCAAGAAGCTAGAAGCTAAGGGTGGTGATGGAGGAACAACATGGGATG
ACGGCGCTTTCGACGGCATACGGAAAGTATCTGTAGGACAAACCTATGATGGTATAGGAGCGGTTAAGTTTGTGTACAAC
AAAGGTTCTTCAGAAATCATAGGAGATGAACATGGAAAGAGTACTCTACTCGGATTCGAAGAGTTTGAGCTTAACTATCC
AAGTGAGTACATCACGGAAGTACATGGCACATACGATAAAATCTCAGCGAGCAACTCCGCGATCGTTAACATGCTTACGT
TCAAGACTAATAAGCCCGCAACATATGGTCCCTTCGGTCTTAACGCTGGCACACCGTTCGATCTCAAAGAGGAAGGCCAC
AAGATCGTTGGGTTCCATGGAAGTTCTGGTGATCTGCTTCACAAATTTGGAGTCCATGTTCTTCCCATCAACTAA