Details for Kale Locus Bo5g124900

Position : C5 ( 5`- 38325754 .. 38328863 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g124900

Protein [Map View]
MYRTAALRAKALKGCLSRSFRASRYASSTAAAAAAAATVSPVFSGSSLPSLNIPLDGVSLPPSLPDNLGPSKLQTTTLPN
GLKIASEMSPNPAASVGLYVDCGSIYETPFSRGATHLLERMAFKSTLNRSHVRLVREIESMGASTSASSSREQMGYTINA
LKTYVPQMVEVLVDSVRNPAFVDWEVNDELRKMKVEIGELAKNPMGYLLEAVHSAAYSGAMANPMYAPESAISGLTGDVL
EKFVSENYTAPRMVLAASGVEHEELLKVVEPLLSDLPNVTRPVEPNSQYVGGDFRQHNGDEATHFALSFGVPGWDKEKEA
VMATVLQMLMGGGGSFSAGGPGKGMHSWLYLRILNQYQEFQSCTAFTSIFNNSGLFGIYGCTSPEYAAKGIELVADEMKA
VAEGKVNQKHLNRAKAATKSAILMNLESRMIVAEDIGRQILTYGERKPVDAFLKTVDQLTLKDIADFTSKIIAKPLTMGS
LGAVLNVPSYDSVSSRFS*

DNA
ATGTACCGCACGGCAGCTTTACGAGCCAAGGCCCTTAAGGGCTGTCTTAGCCGCAGTTTCAGGGCATCACGCTATGCAAG
CTCTACTGCTGCTGCTGCTGCTGCTGCTGCAACGGTTTCACCAGTTTTCTCCGGTAGCTCGCTTCCTTCGTTGAACATTC
CCTTGGACGGTGTCTCTCTTCCACCATCACTCCCTGACAATCTCGGGCCTAGCAAGCTTCAGACCACTACTCTTCCCAAT
GGTCTCAAAATAGCCTCTGAGATGTCTCCGAATCCAGCAGCTTCCGTTGGTTTATACGTTGACTGTGGTTCTATCTACGA
GACACCTTTTTCCCGTGGAGCTACGCACTTGCTTGAGAGGATGGCTTTTAAGAGTACGCTGAACAGATCCCATGTTCGTC
TTGTGAGGGAGATAGAGTCTATGGGAGCTAGTACTTCAGCCTCTTCTTCCCGAGAGCAGATGGGTTACACTATTAATGCT
CTCAAAACCTATGTTCCTCAAATGGTTGAAGTGCTTGTCGACAGTGTGAGGAACCCTGCTTTCGTGGATTGGGAAGTCAA
CGACGAGCTCAGGAAAATGAAAGTGGAGATAGGAGAACTTGCAAAGAACCCTATGGGTTATCTCTTGGAGGCGGTTCATT
CTGCTGCTTACTCTGGCGCAATGGCAAATCCTATGTATGCACCTGAATCTGCAATTAGCGGCTTGACTGGAGACGTCTTG
GAGAAGTTTGTTTCCGAGAACTACACTGCTCCACGAATGGTATTAGCAGCTAGTGGAGTTGAACATGAGGAGCTTTTAAA
AGTGGTTGAGCCATTACTATCTGACCTTCCTAATGTAACTCGACCAGTGGAGCCTAACTCTCAATATGTTGGTGGAGATT
TTCGTCAACATAATGGTGATGAGGCAACACATTTTGCGCTTTCTTTTGGAGTGCCAGGGTGGGATAAGGAGAAGGAAGCT
GTTATGGCCACTGTTCTTCAGATGCTTATGGGAGGAGGTGGCTCATTCTCTGCGGGTGGTCCTGGCAAGGGAATGCACTC
TTGGCTCTATCTCCGCATTTTGAACCAATACCAGGAGTTTCAATCATGCACTGCATTCACTAGCATCTTTAACAATTCCG
GGTTGTTTGGGATCTATGGTTGCACTAGTCCTGAGTATGCTGCAAAGGGAATTGAATTAGTAGCTGATGAAATGAAAGCT
GTTGCTGAAGGAAAAGTCAACCAAAAACATCTTAATCGCGCCAAGGCAGCAACTAAATCTGCAATTTTGATGAATCTTGA
ATCTCGGATGATTGTAGCAGAAGACATTGGTAGACAGATACTTACATACGGGGAGAGGAAGCCAGTGGATGCATTCTTAA
AGACAGTGGACCAACTCACCTTAAAGGACATTGCAGATTTCACCAGCAAGATTATTGCAAAACCGTTGACGATGGGATCT
TTAGGAGCAGTGTTGAATGTTCCAAGCTACGACTCCGTAAGCAGTAGATTTTCTTGA