Details for Kale Locus Bo5g124890

Position : C5 ( 5`- 38322475 .. 38323917 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g124890

Protein [Map View]
MGRAARWFKGIFGMKKSKEKEYRVSGDGGGEAGESLIHRKVLQADNLWLRTYLAETDKEQNKHAIAVAAATAAAADAAVA
AAQAAVAVVRLTSNAKTGGYSGGNVVYGTTMERWAAVKIQSVFKGYLARKALRALKGLVKLQALVKGYLVRKRAAETLHS
MQALIRAQTNARSQRINRNHMFHPRHSLERFDDSRSEIHSKRMSSSVEKHIYNNTYDETSPKIVEIDTYKTKSRSRRMNV
AVSECGDEDFEWSFRGEKCKFPTAQNTPRFSSSAAMNNNYYYTPPSPAKSVCRDACYKPSYPGLMTPSYMANTLSFRAKA
RSHSAPRQRPDRKRLSLDEIMAARSSVSGVRMVQPQPPLLQQQQEKRSSCIYDRQLPQEPAGFRFYN*

DNA
ATGGGTAGAGCAGCGAGATGGTTCAAGGGCATTTTCGGTATGAAGAAGAGCAAAGAGAAAGAGTACCGAGTTTCCGGCGA
CGGAGGAGGAGAAGCCGGTGAGTCTCTCATCCACCGGAAAGTTCTCCAAGCAGACAACCTCTGGCTCAGAACATACTTGG
CGGAAACAGACAAAGAACAGAACAAACACGCCATTGCGGTTGCTGCCGCCACTGCCGCAGCCGCAGACGCAGCAGTTGCA
GCGGCTCAAGCTGCCGTCGCGGTGGTCAGGCTAACAAGTAACGCGAAAACCGGAGGATATTCCGGTGGGAACGTAGTTTA
CGGGACCACAATGGAGCGGTGGGCCGCGGTGAAGATTCAAAGTGTCTTCAAGGGCTATTTGGCGAGGAAAGCGTTAAGAG
CGTTGAAAGGTCTAGTGAAGCTACAAGCTCTAGTGAAAGGATACTTAGTTCGCAAACGCGCAGCCGAAACGCTTCATAGC
ATGCAAGCTCTCATCAGAGCACAAACGAACGCTCGGTCTCAACGCATAAACCGTAACCACATGTTCCACCCTCGACATTC
TCTTGAGAGGTTTGATGATTCAAGAAGCGAGATCCATAGCAAGAGAATGTCAAGCTCTGTCGAGAAACATATCTACAACA
ACACTTATGATGAGACCAGTCCCAAGATTGTTGAGATTGACACTTACAAGACTAAGTCAAGATCGAGGAGAATGAATGTT
GCTGTATCCGAATGTGGAGATGAAGATTTCGAATGGAGTTTTCGTGGAGAGAAATGTAAATTTCCCACAGCTCAAAACAC
GCCAAGATTCTCTTCATCGGCGGCAATGAATAATAATTATTACTACACACCGCCTTCGCCGGCAAAAAGCGTTTGCAGAG
ACGCTTGTTATAAGCCGAGTTATCCTGGTTTGATGACACCTAGCTATATGGCTAATACGCTGTCGTTTAGAGCCAAGGCA
CGTTCGCATAGTGCGCCGAGACAGCGTCCTGATAGGAAGAGGTTGTCGCTTGATGAGATTATGGCGGCTAGGAGTAGCGT
TAGCGGCGTGAGGATGGTACAACCGCAACCGCCGTTACTGCAACAGCAACAAGAGAAACGTTCTTCTTGTATTTATGATC
GTCAGCTTCCTCAAGAACCGGCTGGTTTTAGATTCTATAATTAG