Details for Kale Locus Bo5g124880

Position : C5 ( 5`- 38301226 .. 38302636 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g124880

Protein [Map View]
MEGCPRSRETCPKLLDLIPQERKWYHDEEKNNSDQEKKLELRLAPPGGDEEDHSAMKKKKNLDTRNNIKKEAEDKPIFNL
SGNHFSPSNKTTYAPPHISHKRTAPGPVVGWPPVRSFRKNLASSSSSKLGNDQINKSGEGEKQVEPKREGMFVKINMDSV
PIGRKVDLNAYSTYEQLSFAVDKLFRGLLAAQRDASGGEGEEKPIIGLLNGKGEFTLTYEDNEGDKMLVGDVPWQMFISS
VKRLRVIKSSEISSALKFGCSKQEKMRN*

DNA
ATGGAAGGTTGTCCAAGAAGCAGAGAAACATGTCCTAAGCTCCTTGATTTGATTCCTCAAGAAAGAAAATGGTACCATGA
TGAAGAGAAGAACAACTCAGATCAAGAAAAGAAACTTGAGCTAAGGCTTGCACCACCCGGTGGTGATGAAGAAGATCATT
CAGCTATGAAGAAGAAGAAGAACTTAGATACAAGAAACAACATCAAGAAGGAAGCTGAAGACAAACCTATCTTCAATCTC
AGTGGAAACCATTTCTCTCCTTCCAACAAAACCACGTATGCTCCTCCTCACATCTCTCATAAAAGGACTGCTCCTGGGCC
AGTGGTGGGATGGCCTCCGGTTCGTTCGTTCAGAAAGAATCTAGCGAGCTCAAGCTCTTCAAAGCTCGGAAACGATCAAA
TCAACAAGAGTGGTGAGGGAGAGAAGCAAGTCGAACCTAAGAGGGAAGGAATGTTTGTAAAGATCAACATGGATAGTGTT
CCAATAGGTAGAAAAGTCGATCTCAATGCTTACAGTACCTACGAACAGCTCTCTTTTGCCGTTGACAAACTCTTCAGAGG
TCTACTCGCAGCTCAAAGAGATGCCTCTGGTGGTGAAGGAGAGGAGAAACCGATCATTGGTTTATTGAATGGTAAAGGAG
AATTTACTTTAACGTATGAAGACAATGAAGGAGACAAGATGCTTGTTGGGGATGTTCCTTGGCAAATGTTCATTTCATCT
GTGAAGAGACTGCGTGTGATTAAAAGCTCTGAGATTTCATCTGCCTTGAAATTTGGATGCAGTAAGCAAGAGAAAATGAG
GAACTGA