Details for Kale Locus Bo5g124870

Position : C5 ( 5`- 38294376 .. 38296566 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g124870

Protein [Map View]
MEKQEAIVLYPSPPIGHLVSMVELGKLILSQNPSLSIHIILVPPPYQPESTTTYISSVSSSFPSITFHRLPTVTPYSSAT
TQSHEALILEIICFSNPNVHRTLFSISQTFNLRAMIIDFFCTAVLDVVAGDFAFPVYYFFTSGAACLAAFFHLPTLDETT
AGKNLKDIHTLLNIPGVPPIKGSDMPTRLLDRNDEVYDAFISFSKQLSNTSGIIINTFEALENRAIKAITEELCFRNIYP
IGPLIVKTRTGDNKNADSCLNWLDSQPEQSVVFLCFGSLGLFSQEQLKEIAIGLERSEQRFLWVVRNPPELQNQTEPDLE
SLLPDGFLNRTGNRGMVVKSWAPQVPVLNHKAIGGFVTHCGWNSILEAVCAGVPMVAWPLYAEQRFNRAVIVEEIKIAIS
MNKTETGFVSSMEVEKRVREVVEEGPVRERTKAMKNAAESALVETGSSRHALTALLESWSPKQT*

DNA
ATGGAGAAGCAAGAAGCAATAGTTCTGTATCCATCACCACCAATAGGTCACCTAGTATCCATGGTCGAGCTAGGCAAACT
CATCCTCTCCCAAAACCCATCTCTCTCCATCCACATCATCTTAGTCCCACCTCCTTACCAGCCCGAATCAACCACCACCT
ACATCTCCTCCGTCTCCTCCTCCTTCCCTTCAATCACCTTCCACCGCCTCCCAACCGTCACACCCTACTCTTCAGCAACC
ACACAAAGCCACGAGGCACTCATCTTAGAAATCATCTGCTTCAGCAACCCGAACGTCCACCGTACTCTCTTCTCCATCTC
CCAAACATTCAACCTCCGTGCCATGATCATCGACTTCTTCTGCACCGCCGTGCTAGACGTCGTCGCCGGTGACTTCGCTT
TCCCGGTTTACTACTTCTTCACCTCCGGAGCCGCCTGTCTCGCCGCCTTCTTCCATCTCCCGACTCTTGACGAAACAACT
GCCGGAAAAAACCTCAAAGACATCCACACGCTGCTCAACATCCCCGGCGTTCCTCCGATCAAAGGCTCCGATATGCCTAC
CCGGCTACTTGACCGCAACGATGAGGTTTACGATGCATTTATATCGTTCTCTAAGCAGCTCTCGAACACTTCAGGGATCA
TTATCAACACCTTTGAGGCGTTAGAGAACAGAGCCATCAAGGCCATAACAGAGGAGCTCTGTTTTCGCAATATTTATCCG
ATCGGACCCCTCATTGTTAAGACAAGAACCGGAGATAATAAAAACGCAGATTCTTGTCTGAACTGGCTAGATTCGCAACC
CGAACAGAGTGTTGTGTTCCTCTGTTTCGGGAGCTTGGGTTTGTTCTCGCAAGAACAGCTTAAGGAGATTGCTATCGGTT
TAGAGAGAAGCGAGCAGAGGTTCTTGTGGGTGGTTCGTAATCCACCAGAGCTACAAAACCAAACAGAACCGGATTTGGAG
TCTCTATTACCGGATGGGTTTCTAAACCGAACCGGAAACAGGGGAATGGTGGTTAAATCATGGGCTCCGCAAGTTCCGGT
TCTGAATCATAAAGCAATCGGTGGGTTCGTGACTCATTGCGGATGGAACTCTATTCTTGAAGCTGTTTGCGCGGGTGTAC
CGATGGTGGCTTGGCCGTTATATGCTGAGCAGAGGTTTAATAGAGCGGTGATTGTGGAGGAGATCAAGATTGCTATTTCG
ATGAATAAAACGGAGACAGGCTTCGTGAGTTCCATGGAGGTGGAGAAACGAGTTCGAGAGGTAGTGGAGGAGGGTCCGGT
TAGGGAGAGGACCAAGGCTATGAAGAATGCAGCTGAATCAGCTTTGGTTGAAACCGGTTCGTCTAGGCACGCGTTGACTG
CTTTACTCGAGTCGTGGAGTCCAAAACAAACTTAG