Details for Kale Locus Bo5g124860

Position : C5 ( 5`- 38291216 .. 38292827 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g124860

Protein [Map View]
MQQETLSDPYGEIEISFGYQCNNKKIGIPEDAIVPDSRGVLAGFRLQKTSSFSCLSGAALSGNPTLANTNICNGVIGSEI
LPSLDSPKSFRKVPSSPALSKLDILSPSLHGSMASLSCSPSPPEPESCFLTSMSSPSSLNEGFVLSAMEVQVAGGAAGED
RVQAVCSEENGWLFCAIYDGFNGRDAADFLACTLYESIVFHLQLLDHQMKTHHDVDDGGVSVIVDSSSSDLFRQGVLDCL
NRALLQAENDFLRMVEQEMEERPDLVSVGSCVLVTLLVGKDLYIMNLGDSRAVLATYSGNKKLQAVQLTEDHTVDNEIEE
ARLLSEHLDDPKIVIGGKIKGKLKVTRALGVGYLKKEKLNDALMGILRVRNLLSPPYVSVEPSMRVHKITESDHFVIVAS
DGLFDFFSNEEAIELVHGFIASNPCGDPAKYLLERLVAKAAARVGFTLEELLNVPAGRKRRYHDDVTVMVITLGTDQRTS
KASTFV*

DNA
ATGCAGCAAGAGACGTTAAGTGATCCTTATGGAGAGATTGAGATAAGCTTTGGCTATCAATGCAATAACAAGAAGATAGG
AATCCCTGAAGATGCTATTGTTCCTGATAGCCGCGGCGTTCTCGCTGGCTTTAGGCTTCAAAAGACAAGCAGCTTCTCTT
GTCTATCAGGTGCTGCTTTAAGCGGCAACCCTACGCTAGCCAACACCAACATCTGCAACGGAGTCATCGGCTCCGAGATT
CTACCCTCTCTAGACTCTCCCAAATCCTTCAGGAAGGTTCCATCTTCCCCCGCGCTTTCCAAGCTCGACATACTCTCTCC
TTCTCTCCACGGAAGCATGGCGAGTCTCAGCTGCAGCCCTAGTCCTCCCGAGCCGGAGTCTTGCTTCTTGACCTCCATGA
GCTCTCCTTCCTCTCTGAACGAAGGGTTTGTTCTCTCTGCTATGGAAGTTCAAGTCGCCGGAGGTGCTGCTGGTGAAGAT
AGAGTTCAGGCCGTTTGCTCTGAGGAGAACGGCTGGCTCTTCTGCGCTATCTACGACGGATTCAACGGAAGAGATGCTGC
TGATTTCTTGGCTTGTACTTTGTACGAGTCCATTGTTTTCCATCTCCAGCTGCTTGATCACCAGATGAAGACGCATCACG
ATGTTGATGATGGAGGCGTAAGTGTAATAGTAGACTCTTCTTCCTCTGATTTGTTCAGACAAGGAGTGTTGGATTGCTTG
AACCGCGCGCTTCTCCAGGCGGAGAACGATTTCTTGAGGATGGTTGAGCAAGAGATGGAGGAAAGACCGGACTTGGTGTC
TGTTGGCTCTTGCGTTCTTGTCACTCTACTCGTCGGGAAGGATCTTTACATCATGAATCTAGGGGATAGCAGAGCTGTGC
TGGCAACGTACAGTGGAAACAAGAAGCTTCAAGCTGTTCAGCTCACGGAGGATCACACTGTTGATAACGAAATCGAAGAA
GCTAGGCTATTGAGTGAGCATCTTGATGATCCTAAAATTGTTATTGGTGGGAAGATCAAAGGAAAGCTTAAAGTCACTCG
TGCTCTAGGAGTTGGTTACTTGAAGAAGGAGAAACTGAACGATGCATTGATGGGGATTCTACGAGTTCGTAACCTTTTGA
GCCCACCTTACGTGTCGGTGGAACCATCGATGAGAGTTCACAAGATCACGGAGTCAGATCACTTCGTTATAGTTGCAAGC
GATGGTCTGTTTGATTTCTTCAGCAACGAGGAGGCGATAGAACTCGTGCACGGCTTCATTGCTAGTAATCCTTGTGGTGA
TCCAGCAAAGTATCTGCTTGAACGTCTTGTAGCTAAAGCTGCTGCTCGTGTTGGATTCACGTTGGAAGAATTGCTGAATG
TTCCGGCTGGTAGGAAAAGGAGATATCATGACGATGTGACTGTGATGGTTATCACTCTCGGTACTGATCAACGCACCTCA
AAGGCTTCTACGTTCGTGTGA