Details for Kale Locus Bo5g124850

Position : C5 ( 5`- 38283839 .. 38285797 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g124850

Protein [Map View]
MDSPPPTKLDYHVDMFKLQSQATFLSLFKAEDGRMALILDSTVFHPQGGGQPSDTGLIEFAGSDFKFSVQDVRSKDGIVL
HYGVFQGSVPEDIAKGQDVQLLVDQSRRKLNSRLHSAGHLLDLCMRKVGLGHLEPGKGYHFPDGPFVEYKGVVPQAELQV
KQKELEAEANEMISKGGKVYADILPYEEASLLCGGSLPDYIPKGSTPRVLRLGENPGCPCGGTHVSDISDIISMKITQMR
TKKGMTKVFYTIAS*

DNA
ATGGATTCTCCTCCTCCGACGAAGCTTGATTATCATGTAGACATGTTTAAACTTCAATCCCAAGCCACGTTTCTCTCCTT
ATTCAAGGCGGAGGATGGACGTATGGCTCTTATATTAGACTCGACGGTTTTTCATCCGCAAGGTGGAGGTCAGCCGTCGG
ATACCGGTTTAATCGAATTCGCCGGTTCGGATTTCAAGTTCTCTGTTCAAGATGTTCGATCCAAAGATGGAATCGTTCTC
CATTACGGAGTTTTCCAAGGTTCAGTTCCTGAAGATATTGCAAAGGGGCAAGACGTTCAGTTGCTTGTTGATCAATCAAG
GCGCAAACTCAATTCCAGGTTGCACTCAGCTGGACACTTGCTGGATTTGTGTATGCGGAAAGTTGGGTTGGGACATTTGG
AGCCTGGGAAAGGGTACCATTTCCCTGACGGTCCTTTTGTGGAATACAAAGGAGTCGTTCCACAGGCTGAACTGCAGGTG
AAGCAGAAAGAGTTGGAGGCAGAGGCTAATGAAATGATTTCCAAAGGAGGAAAGGTTTATGCTGATATACTACCCTATGA
AGAGGCATCCCTGCTCTGTGGTGGCAGTCTTCCTGATTATATTCCCAAGGGCAGCACTCCCCGAGTCTTAAGATTAGGTG
AAAACCCTGGGTGTCCGTGTGGTGGAACCCATGTCTCCGATATATCCGATATCATAAGCATGAAGATCACACAGATGAGA
ACAAAGAAAGGAATGACCAAAGTTTTCTACACCATTGCATCTTAA