Details for Kale Locus Bo5g123790

Position : C5 ( 5`- 38198239 .. 38209151 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123790

Protein [Map View]
ISKEVITSLLPRVHVLAFESESSPHLSLKLAPQRRSQRGQMQHTNAAAATALYDAGPANDAGDAVMARWLQSAGLQHLAS
PTGGNDQRHLPSLLMQGYGAQTAEENQRLFKLMRNLNLNGESSESYTPTAAMPSSEGFFSPDFRGDFGAGLMDLHAMDDT
ELLSEHVSAEPFEPSPFMPSVDKEFEEGFNFPTNRQQQTDAEPLGSLPKSEKENNSVAKIKVVVRKRPLNKKETARKEDD
VVTVSDNSLTVHEPKLKVDLTAYVERHEFCFDAVLDEDVSNDEVYRATIEPIIPIIFQRTKATCFAYGQTGSGKTYTMKP
LPIRAVEDLMRLLRQPVYSNQKFKLWLSYFEIYGGKLFDLLSERKKLLMREDGRQQVCIVGLQEYEVSDVQIVKELIDKG
NAERSTGSTGANEESSRSHAILQLVVKKHVEVKQTRRKNNDATELPGKVVGKISFIDLAGSERGADTTDNDRQTRFEGAE
INKSLLALKECIRALDNDQLHIPFRGSKLTEVLRDSFVGNSRTVMISCISPSVGSCEHTLNTLRYADRVKSLSKSGNSKK
DLTANSMPPVNKDSLLGSNDVEDIFEPPQVVNVQETGRRVEKDNYTASGIDFRQPTNYREESGIPSISMDKSRSETNNAF
GGSNSQRNHLSSYPQETSDREDKAKKVSPPRGKGLREEKPDRPPQNLSSYAKETSDREEKVSPPRGKVLREEKPDRPPQN
LSSYPQETSDREEKAKKVSPPRGKGLREEKPDRPQNLSKREVRSSDIPTFTNFRQNTSETVSRQYETDSSLDENIDALLE
EEEALITAHRKEIEDTMEIVREEMKLLAEVDKPGSMIENYVTQLSFVLSRKAAGLVSLQARLARFQHRLKEQEILSRKRF
PPRSDMEEQKLADDRNSDEQVERIELVVSDVDARDTEDEVFEEAIDSSKPESFQADDGLHEDLPSEEVKVPEVNGESHGE
ANLQHITTGEAATGFVTSQMNGDEGEAGAENVSDTATLSFSENGIVSPEKKAVLLSFGSEKEEKKLGDDRIIHDQVENST
LLVSDVDARDTYDEVFVEAIDGFQADDGLHEDLPSKATPEHSMDDLEEENSNDKEVKDSKVSGETHGETNLQHITEGEAA
PGFVTSKMNGDEGESGAEHVNEKVTSSFSENGIVSPEKKQLVAEVIEETRNDGTEEENREQNVDVSAGMETEQEAGKREG
ADKDCFENESGAQRNGETVAEYNTVKCASGDSIQVASGEKSLNDSIEVDCAGTSSPLEKSSSEENGESEGHISREHDPAQ
NSNGGLGVEHTSQPNKEFEKQQGSRVNISPEIKESPHLERKSEVANSVSPTESISPARPAGLGRDAPLLEPTPRVPHQPR
VNGNASQNQSEQAEDPTTAETDEHDETREKLQLIRVKFLRLSHRLGQTPHNVVVAQVLYRLGLAEQLRGRNGSRVGAFSF
DRASSMAEQLEAAGQDPLDFSCTVMVLGKSGVGKSATINSIFDEVKICTDAFQMGTKRVQEVEGFVQGIKVRVIDTPGLL
PSWSDQHKNEKMLKSVKAFIKKNPPDIVLYLDRLDMQSRDSGDTPLLRTITDVFGPSIWFNAIVGLTHAASAPPDGPNGT
ASSYDMFVTQRSHVIQQAIRQAAGDMRLMNPVSLVENHSACRTNRAGQRVLPNGQVWKPHLLLLSFASKILAEANALLKL
QDNNTPGRPFVARSKAPPLPLLLSSFLQSRPQAKLPEEQYGDEEDEDDLDESSGSDEESEYDQLPPFKRLTKSEMARLSK
SQKKQYLDEMEYRETLFLKKQMKEERKRRKMLKKFAAEIKEFANGHSENVEEERSEPASVPVPMPDLSLPASFDSDNPTH
RYRSLDSSNQWLVRPVLETQGWDHDVGYEGVNAERLFVVKEKIPISFSGQVTKDKKDANVQLEMASSVKHGEGRSTSLGF
EMQNAGKELAYTVRSDTRFNNFRKHKAAAGLSVTLLGDSVSAGLKVEDKLIANKRFRMVMCGGAMTSRGDVAYGGSLEAQ
LRDKDYPLGRFLSTLGLSVMDWHGDLAIGGNIQSQVPIGRSSNLIARANLNNRGTGQVSVRVNSSEQLQLAMVAFVPLFK
KLLSYYSPQQMEKLLMGEDGRQEVYIVGLQEYEVSYVQIVKELVEKGAQVKEVQKPQKITARQGEDALYPSWLSTDVGPT
NDAGDDVMACWQ*

DNA
ATTTCAAAGGAAGTGATAACGAGTTTGCTACCTCGCGTTCATGTTCTTGCGTTTGAATCCGAATCCTCTCCGCATCTATC
TCTCAAGTTGGCTCCTCAAAGAAGATCGCAGCGCGGCCAGATGCAGCACACCAACGCCGCTGCTGCGACTGCTCTTTACG
ATGCGGGACCCGCTAATGACGCTGGAGATGCTGTCATGGCACGCTGGCTCCAATCCGCTGGCTTGCAGCATCTGGCCTCT
CCCACCGGAGGCAATGATCAGCGTCATCTCCCTAGCCTTCTCATGCAGGGTTATGGAGCGCAGACTGCTGAAGAAAATCA
AAGGCTGTTCAAACTAATGCGAAATCTTAATCTTAACGGGGAGTCCTCTGAATCATATACACCAACAGCAGCTATGCCTT
CTTCCGAAGGATTTTTTTCACCCGACTTCAGAGGTGATTTTGGAGCTGGGTTAATGGATCTTCATGCTATGGATGACACA
GAGCTGCTATCTGAGCATGTGAGTGCCGAACCCTTTGAGCCGTCACCTTTCATGCCTAGTGTGGATAAAGAATTTGAAGA
AGGTTTTAATTTTCCAACTAATCGTCAGCAACAAACAGATGCTGAACCTTTGGGCTCATTGCCTAAGAGTGAAAAAGAGA
ATAACAGTGTAGCCAAGATTAAAGTAGTGGTAAGGAAAAGACCCCTAAATAAGAAAGAAACAGCTAGAAAGGAGGATGAT
GTCGTGACGGTATCTGATAATTCTTTGACTGTCCATGAGCCCAAGCTGAAGGTGGATTTGACTGCTTATGTGGAGAGGCA
TGAGTTCTGCTTTGATGCTGTTCTAGATGAGGATGTTTCAAATGACGAGGTGTATAGGGCCACAATTGAGCCGATAATTC
CCATTATTTTCCAGAGAACTAAAGCTACATGTTTTGCATATGGTCAAACAGGTAGTGGTAAGACATACACAATGAAACCA
CTACCCATACGCGCTGTCGAAGATTTAATGAGGCTGTTGCGTCAACCAGTATACAGCAATCAGAAGTTTAAATTGTGGCT
CAGTTATTTTGAGATATATGGTGGAAAGCTGTTCGATCTTCTCAGTGAGAGAAAGAAGCTTTTAATGCGAGAAGATGGTA
GACAACAAGTTTGCATTGTTGGGCTGCAAGAGTACGAAGTCTCAGATGTTCAAATTGTAAAGGAACTTATCGACAAAGGA
AATGCTGAAAGGAGCACAGGTTCAACTGGAGCAAATGAGGAATCTTCTAGATCACATGCTATCTTACAGCTTGTTGTAAA
GAAGCATGTTGAGGTAAAACAAACCAGACGTAAAAATAATGATGCCACTGAATTGCCTGGGAAAGTTGTTGGGAAGATTT
CTTTCATTGATCTTGCTGGCAGTGAAAGAGGTGCAGACACCACAGACAATGACCGACAGACAAGGTTTGAAGGCGCAGAA
ATCAATAAGAGTCTTTTGGCTCTCAAGGAATGTATACGTGCACTGGACAATGACCAGCTACATATACCATTCCGTGGAAG
CAAATTAACTGAAGTGCTCCGTGACTCATTTGTTGGAAACTCAAGAACGGTGATGATCTCTTGCATCTCTCCGAGTGTAG
GATCGTGTGAACATACCCTCAATACACTAAGATATGCTGATCGGGTCAAAAGTCTATCTAAAAGTGGAAATAGCAAGAAA
GATCTAACTGCAAACTCAATGCCTCCTGTTAATAAGGATTCTCTGTTGGGCTCAAATGATGTAGAAGATATCTTTGAGCC
ACCACAGGTAGTGAATGTTCAGGAAACCGGGAGGAGGGTCGAGAAGGATAACTACACTGCTTCAGGTATTGACTTCAGAC
AACCTACAAATTATCGAGAGGAAAGTGGAATCCCATCAATCTCAATGGACAAGAGTAGATCAGAGACGAACAATGCTTTT
GGTGGCTCCAATAGTCAGAGGAACCACCTGTCTTCATATCCTCAAGAAACTTCAGACCGCGAAGATAAAGCCAAGAAAGT
GTCGCCACCTCGTGGGAAAGGGCTGCGGGAAGAAAAACCGGATAGACCACCACAAAACTTGTCTTCATATGCCAAAGAAA
CTTCAGACCGTGAAGAGAAAGTGTCTCCACCTCGTGGGAAAGTGTTGCGGGAAGAGAAACCAGATAGACCACCACAAAAC
TTGTCTTCATATCCCCAAGAAACTTCAGACCGTGAAGAGAAAGCCAAGAAAGTGTCACCACCTCGTGGGAAAGGGCTGCG
GGAAGAAAAACCAGACAGACCACAAAACTTGTCTAAAAGAGAGGTCAGGTCGTCAGACATCCCTACCTTTACAAACTTCA
GGCAGAACACAAGTGAAACTGTTTCAAGACAATATGAAACCGACTCTTCGCTTGATGAAAACATTGATGCACTGCTTGAG
GAAGAGGAAGCTCTGATTACAGCACACAGAAAAGAAATAGAGGATACAATGGAGATTGTTCGCGAGGAGATGAAGCTTTT
AGCGGAGGTGGACAAACCAGGAAGCATGATAGAAAACTATGTAACGCAACTGAGCTTTGTCTTGTCGAGGAAAGCAGCGG
GGCTTGTGAGTCTCCAAGCCAGGCTTGCTCGGTTCCAACACCGTCTCAAGGAACAAGAAATACTTAGCCGTAAGAGATTT
CCTCCTCGGTCAGATATGGAAGAGCAGAAGCTTGCAGACGATAGAAACAGCGATGAGCAAGTAGAGAGAATTGAATTGGT
GGTTTCTGATGTTGATGCGAGGGATACCGAAGATGAGGTCTTTGAGGAAGCTATCGACAGTTCAAAGCCTGAATCTTTTC
AAGCCGATGATGGGTTACACGAGGATTTACCTTCAGAGGAAGTGAAAGTGCCAGAGGTTAATGGAGAGAGCCATGGTGAG
GCAAACCTGCAACATATAACTACGGGAGAGGCTGCAACAGGTTTTGTGACTTCCCAAATGAATGGTGATGAAGGGGAAGC
AGGTGCAGAGAATGTCAGCGACACTGCTACACTTTCTTTTTCTGAAAATGGAATTGTCTCCCCTGAGAAGAAAGCTGTTC
TCCTCTCTTTCGGGTCAGAGAAGGAAGAGAAGAAGCTTGGAGACGATAGAATCATCCATGACCAAGTAGAGAACAGTACA
TTACTGGTTTCTGATGTTGATGCAAGGGATACCTATGATGAGGTCTTTGTGGAAGCTATTGACGGTTTCCAAGCCGATGA
TGGGTTGCACGAGGATTTACCTTCAAAGGCAACTCCTGAACATTCCATGGATGATCTGGAAGAAGAGAATAGCAATGACA
AGGAAGTGAAAGATTCCAAGGTTAGTGGAGAGACCCATGGTGAGACAAACCTGCAACATATAACTGAGGGAGAGGCTGCA
CCAGGTTTTGTGACTTCCAAAATGAATGGGGATGAGGGGGAATCAGGTGCAGAGCATGTGAACGAGAAAGTTACAAGTTC
CTTTTCTGAAAATGGAATCGTCTCGCCTGAGAAGAAACAGCTGGTGGCTGAAGTGATCGAGGAAACAAGGAATGATGGTA
CTGAAGAGGAAAACAGGGAGCAAAATGTTGATGTATCAGCTGGTATGGAAACAGAACAAGAGGCTGGGAAACGTGAAGGA
GCAGATAAGGATTGCTTTGAGAATGAGTCTGGGGCACAAAGAAATGGTGAGACTGTTGCCGAATACAACACTGTTAAATG
TGCTTCAGGTGATAGCATTCAGGTAGCTTCGGGTGAGAAATCCTTGAATGATAGTATTGAAGTAGATTGCGCTGGGACCT
CATCTCCATTGGAGAAATCTAGTTCCGAGGAAAATGGAGAGAGTGAAGGTCACATCAGTAGAGAACATGATCCAGCTCAA
AACAGTAATGGAGGACTTGGGGTTGAACATACTTCTCAACCTAATAAGGAATTTGAGAAGCAGCAAGGCAGCAGAGTGAA
TATAAGTCCAGAGATTAAGGAAAGCCCACATTTGGAAAGAAAATCTGAGGTAGCAAATTCTGTTTCACCAACAGAGTCTA
TAAGTCCTGCTCGCCCAGCAGGCCTTGGGCGGGATGCTCCTCTTTTGGAACCCACCCCACGTGTTCCTCATCAGCCTCGT
GTAAATGGCAATGCGTCTCAGAATCAGTCTGAGCAGGCAGAAGACCCTACCACTGCCGAGACCGATGAGCATGATGAGAC
CCGTGAGAAGCTCCAGTTGATCAGGGTCAAGTTTTTGAGGCTTTCACATAGATTAGGGCAAACTCCACATAACGTTGTTG
TTGCTCAAGTTTTGTATAGGCTTGGATTGGCTGAGCAGTTGAGGGGGAGAAACGGAAGCCGTGTGGGTGCCTTTAGTTTT
GATCGAGCAAGTTCCATGGCAGAACAACTTGAGGCAGCTGGACAGGATCCACTTGATTTTTCTTGTACAGTTATGGTGCT
CGGTAAAAGTGGTGTTGGTAAGAGTGCTACGATTAATTCTATTTTTGATGAAGTGAAGATCTGTACGGATGCATTCCAGA
TGGGGACAAAGAGGGTTCAGGAGGTTGAGGGTTTTGTTCAGGGAATTAAGGTTCGGGTGATTGACACTCCAGGTCTCTTA
CCATCATGGTCTGATCAACACAAGAATGAGAAAATGTTGAAGTCTGTTAAGGCTTTCATCAAGAAAAATCCACCGGATAT
CGTATTATATCTTGATAGGCTGGATATGCAAAGCAGAGATTCTGGTGACACGCCTCTCTTGCGCACCATCACTGATGTTT
TTGGACCATCAATATGGTTTAATGCCATTGTGGGTTTGACTCATGCCGCTTCTGCTCCACCAGATGGTCCAAATGGCACT
GCTTCTAGCTATGACATGTTTGTAACACAACGTTCCCATGTCATTCAGCAGGCCATTCGCCAAGCTGCTGGAGATATGAG
GCTCATGAACCCTGTGTCTCTAGTTGAGAACCACTCTGCTTGCAGGACAAATCGGGCAGGTCAGAGAGTCTTACCAAATG
GCCAAGTGTGGAAGCCTCATTTGCTGTTACTCTCATTTGCGTCCAAGATTCTAGCAGAAGCAAATGCTCTTCTGAAATTA
CAAGATAATAATACTCCAGGGAGACCATTTGTAGCTCGATCCAAGGCTCCACCACTGCCACTTCTCCTCTCATCGTTTCT
GCAATCAAGACCGCAAGCCAAACTTCCTGAAGAGCAGTATGGTGATGAAGAAGATGAAGATGATTTGGACGAGTCATCAG
GTTCTGACGAAGAATCAGAGTACGATCAGCTTCCTCCTTTTAAGCGATTGACTAAATCTGAGATGGCGAGGCTTAGTAAA
TCTCAGAAGAAGCAATATCTTGATGAGATGGAGTACCGGGAGACGCTATTTCTGAAGAAGCAGATGAAAGAGGAAAGAAA
GAGACGTAAGATGTTGAAGAAATTTGCTGCCGAGATTAAAGAATTTGCTAACGGGCATAGTGAAAATGTGGAAGAGGAGA
GAAGTGAACCTGCTTCTGTTCCAGTTCCCATGCCAGATTTGTCTCTACCTGCATCGTTCGACTCTGACAATCCTACTCAC
AGGTACCGGTCCCTTGATTCCTCCAATCAGTGGCTTGTTAGGCCAGTCCTGGAAACTCAGGGGTGGGATCATGATGTTGG
CTATGAAGGTGTCAATGCAGAACGACTTTTTGTTGTTAAAGAAAAGATACCGATATCTTTCTCGGGGCAAGTTACAAAGG
ACAAGAAAGATGCAAATGTGCAGCTGGAAATGGCCAGCTCGGTTAAACATGGAGAGGGCAGATCAACCTCCCTAGGTTTC
GAGATGCAAAATGCTGGGAAGGAATTGGCTTACACTGTAAGAAGTGATACCAGATTTAACAATTTTAGGAAACACAAAGC
TGCAGCTGGTCTCTCTGTAACGCTCTTGGGTGATTCGGTGTCTGCGGGTCTGAAAGTTGAGGATAAGTTGATTGCTAATA
AAAGGTTCAGAATGGTTATGTGTGGAGGGGCAATGACTAGTCGAGGAGATGTTGCTTATGGGGGTAGTTTAGAAGCTCAG
TTGAGAGATAAAGATTATCCGCTTGGTAGGTTTTTATCTACTCTAGGACTTTCTGTGATGGATTGGCATGGGGATCTTGC
TATCGGAGGGAATATACAGTCCCAAGTGCCCATAGGACGTTCATCTAATCTAATTGCGCGTGCTAATCTGAACAACAGAG
GGACAGGGCAAGTAAGCGTCCGCGTAAACAGCTCTGAGCAGCTCCAACTTGCAATGGTCGCATTTGTTCCTCTGTTCAAG
AAGCTACTTAGTTATTATTCCCCTCAGCAAATGGAGAAGCTTTTAATGGGAGAAGATGGTAGGCAAGAAGTTTACATTGT
TGGGCTGCAAGAGTATGAAGTCTCATATGTTCAAATTGTAAAGGAACTTGTCGAGAAAGGAGCACAGGTTAAAGAGGTGC
AGAAACCTCAGAAAATAACCGCCAGACAAGGTGAGGATGCTCTTTACCCCTCGTGGCTGAGTACTGATGTGGGACCCACA
AATGACGCTGGAGATGATGTCATGGCATGCTGGCAATGA