Details for Kale Locus Bo5g123780

Position : C5 ( 5`- 38194914 .. 38196046 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123780

Protein [Map View]
MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWTTVGAVDVNIGANPSAEEGGEDEGVDDTTQKVVDIVDTFRLQEQP
TYDKKGFIAYIKKYIKLLTPKLNEEDQAAFKKGIEGATKFLLPKLNDFQFFVGEGMHDDSTLVFAYYKEGATNPTFLYFG
HGLKEVKC*

DNA
ATGTTGGTGTACCAAGATCTTCTCACCGGTGATGAACTTCTGTCTGATTCTTTCCCTTACAAGGAGATTGAGAATGGTAT
TCTTTGGGAAGTTGAAGGAAAGTGGACTACCGTTGGAGCTGTGGATGTGAACATTGGTGCCAATCCCTCTGCCGAAGAAG
GTGGTGAGGACGAGGGTGTTGATGACACGACTCAAAAGGTTGTTGACATTGTGGACACCTTCAGACTTCAGGAGCAGCCG
ACTTATGATAAGAAGGGTTTCATCGCCTATATTAAAAAGTACATCAAGCTTTTGACACCAAAGCTCAACGAGGAAGATCA
AGCAGCCTTCAAGAAGGGTATTGAGGGAGCTACCAAGTTCTTGCTCCCCAAGCTCAATGACTTCCAATTCTTTGTTGGGG
AGGGGATGCATGATGACAGCACTTTGGTCTTTGCTTACTACAAGGAGGGTGCAACTAACCCAACATTTTTGTACTTTGGA
CATGGTTTGAAGGAGGTCAAGTGCTGA