Details for Kale Locus Bo5g123750

Position : C5 ( 5`- 38157042 .. 38157848 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123750

Protein [Map View]
MNSNDQYPMGRPDETTSGSSRTYAMSGKIMLSAIVILFFVVILMVFLHLYARWYLLRARRRHFRRRSRNRRSTMVFFAAD
PSAAAAASRGLDPAVIKSLPVFAFSELTHKDLTECAVCLSEFEEGESGRVLPGCKHTFHVDCIDMWFHSHSTCPLCRSLV
EPPVEEQVAITISPEPVSVAIEPGSSSGLRKPAAIEVPRRNFSEFDDRNSPANHSFRSPMSRMLSFTRMLSRGNASSPIA
GAPPQSPSSNCRIAMTESDIERGGEETR*

DNA
ATGAACTCCAACGACCAATATCCAATGGGCAGGCCCGACGAAACCACCTCCGGCTCTTCTCGAACCTACGCCATGAGCGG
GAAGATCATGCTGAGCGCCATCGTCATCCTCTTCTTCGTCGTCATCCTAATGGTCTTCCTCCACCTCTACGCCCGCTGGT
ACCTCCTCCGCGCTCGCCGCCGTCATTTCCGCCGCCGCAGCCGTAACCGTCGCTCCACGATGGTTTTCTTCGCCGCGGAT
CCTTCCGCCGCCGCCGCCGCCTCGCGCGGCCTCGATCCCGCGGTGATCAAGTCTCTCCCCGTTTTCGCTTTCTCCGAGTT
GACTCACAAAGATCTGACCGAGTGCGCCGTTTGCCTCTCCGAGTTCGAGGAAGGCGAGTCGGGTCGGGTTTTGCCCGGTT
GCAAGCATACGTTTCATGTTGACTGTATAGATATGTGGTTTCATTCTCATTCCACGTGTCCTCTCTGCCGCTCTCTCGTC
GAGCCTCCCGTGGAGGAGCAAGTTGCGATCACGATTTCTCCTGAACCGGTTTCTGTTGCAATTGAACCGGGTTCGAGCTC
TGGATTGAGAAAACCGGCGGCGATTGAGGTGCCGAGGAGGAACTTCAGTGAATTTGACGATCGGAACTCGCCGGCGAATC
ACTCGTTTAGGTCGCCGATGAGTCGTATGTTATCTTTCACTCGGATGCTGAGCAGAGGAAACGCCTCGTCGCCCATAGCC
GGAGCTCCGCCTCAATCTCCGTCGTCTAACTGCCGGATAGCGATGACTGAGTCAGATATAGAGCGTGGAGGAGAAGAGAC
TAGGTGA