Details for Kale Locus Bo5g123740

Position : C5 ( 5`- 38151990 .. 38155141 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123740

Protein [Map View]
MTSNGGERIHTVQPERDLVANWEVDLSEKLEEYLLKICTGEITGNEEEDGKIPVNFAEAALLLQGSVQVYSKKVEYLYNL
VLRTLEFLSKQRDQEESKGTSNEAEASSSRQVDEEENDLFWNVDDIPVDAKNSLDDFVGGDSCPNQFVKPPANLVVLEGD
CLDTSGDGGELESYLLATTHLYRDFILLDPCDAVVVNEFLGDSYAGKRRNSARRGSSARKSFHSPVGRSGGSARRSSVGK
NQGTNFNQSPVNGNGPDAQNCDQGCQSPPAFGDNDHGFDMDNDHGGTMDLSDTDADEDDPWKPLNPYEPGNLKVKPFKKV
KTLRKFGASLTKDHMATMFPLARPNGPISAELSGIWEKRRPSSNNEREPQDIPYYEKLRALLVNGGNQPTDANSNHKEGV
KDNNDEANNGDFNDFGDHGGDDHEHAFMDEDGPGMNHDGGAADFPNHDGFGNDDSHCQESLEDLCRSHLDALLANIAKSE
KQTDLAARVSTWKQKIEQNLEEQELHPPFDIQEYGERIVNKLTVEESGDAETFTDLMKDQEKHDVARAFSALLQLVNNGD
VELEKPGNSVGEPVCYTAVNPFSVRLLSDRNRKAEKTEMRLPRKREKSPTAKGKSPESPPPKKANNTCSVSSQETRKVSL
EISKMNNVGTKCTRKSKKR*

DNA
ATGACGAGTAACGGCGGGGAGAGGATTCACACGGTACAGCCGGAGAGAGATTTGGTGGCGAATTGGGAAGTTGATTTGTC
GGAGAAGCTAGAAGAGTACCTCCTCAAGATATGTACCGGAGAAATCACCGGAAACGAAGAAGAAGATGGGAAGATTCCTG
TTAATTTCGCGGAAGCTGCTTTGTTGCTTCAGGGCTCGGTTCAGGTTTACAGCAAGAAAGTTGAGTACTTGTACAATTTG
GTCTTACGTACATTGGAGTTTCTATCCAAGCAAAGAGACCAGGAAGAGTCCAAAGGTACATCAAACGAGGCTGAGGCAAG
CTCCTCTCGTCAGGTTGATGAAGAAGAAAATGATCTCTTCTGGAACGTGGATGATATCCCAGTGGACGCAAAGAATAGCT
TGGACGACTTCGTTGGTGGAGATTCCTGCCCAAATCAGTTTGTTAAGCCTCCAGCAAATCTAGTTGTTCTTGAAGGTGAC
TGCTTGGATACTAGCGGTGACGGAGGAGAGCTGGAATCTTATCTGTTGGCAACTACACATCTCTACCGGGATTTTATTCT
ATTAGACCCATGTGATGCTGTAGTGGTAAATGAATTTTTAGGTGATAGCTACGCTGGTAAAAGAAGGAACAGTGCTCGTA
GAGGCAGCTCAGCTCGTAAAAGTTTTCACTCACCAGTAGGACGTTCTGGAGGAAGCGCTCGCAGATCGTCTGTGGGAAAG
AATCAAGGAACCAATTTCAACCAGTCACCAGTAAATGGGAATGGTCCCGATGCTCAAAACTGTGACCAAGGGTGTCAGTC
TCCTCCTGCCTTTGGAGACAATGATCATGGCTTTGACATGGATAACGACCATGGAGGAACAATGGATTTGAGTGATACAG
ATGCTGATGAAGATGATCCATGGAAGCCATTGAATCCCTATGAGCCAGGGAATTTGAAAGTGAAGCCTTTTAAAAAAGTT
AAAACTTTGAGAAAGTTTGGAGCGAGCCTTACCAAGGACCATATGGCTACCATGTTTCCTCTTGCTAGACCCAACGGTCC
CATCAGTGCAGAGCTGAGCGGAATTTGGGAGAAACGCCGTCCTTCTAGTAACAATGAGAGAGAACCACAAGACATTCCCT
ATTACGAGAAGCTTCGAGCATTGCTTGTGAATGGAGGAAACCAACCTACTGATGCTAACAGCAATCACAAGGAGGGCGTT
AAGGATAACAATGATGAAGCTAATAATGGCGACTTTAATGATTTTGGAGATCATGGTGGTGATGATCATGAACATGCGTT
CATGGATGAAGATGGTCCAGGCATGAATCATGATGGTGGAGCTGCAGATTTCCCCAACCACGATGGGTTTGGAAACGACG
ACTCGCATTGTCAGGAAAGCTTGGAAGATCTTTGTCGCTCACACCTGGATGCTCTTCTTGCTAACATAGCTAAAAGTGAG
AAGCAAACGGATCTAGCTGCTCGGGTTTCAACTTGGAAACAGAAAATCGAGCAAAACCTAGAAGAACAAGAGCTGCACCC
TCCTTTTGACATTCAAGAATATGGAGAAAGGATTGTCAACAAACTCACTGTTGAAGAGAGTGGAGACGCCGAGACCTTTA
CTGATCTCATGAAAGACCAAGAAAAGCACGATGTAGCCCGGGCTTTCTCCGCGCTTCTCCAGTTGGTGAACAATGGAGAC
GTTGAGCTCGAGAAACCTGGGAACTCGGTAGGCGAACCAGTGTGTTATACAGCGGTGAATCCTTTCAGCGTTCGGTTACT
CAGTGATCGTAACAGAAAGGCTGAGAAAACTGAAATGCGCTTACCCCGGAAACGAGAAAAATCCCCCACAGCCAAAGGCA
AATCTCCAGAGTCACCACCACCAAAGAAGGCAAACAACACATGTTCTGTCTCAAGCCAAGAGACTAGGAAAGTGTCCTTA
GAGATATCAAAGATGAACAATGTCGGCACTAAGTGCACACGGAAGAGCAAGAAGAGATGA