Details for Kale Locus Bo5g123710

Position : C5 ( 5`- 38128623 .. 38129705 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123710

Protein [Map View]
ILSTYTVLSIHHLSSPINAFHVHQTHLSLETQHKSEIKETEKMCGGAIISDFVPILTKAKGRKLTAEELWSELDASAGDY
LWSFHPTSKLQPTNQQEVALKDEAVVKEKEREPATTEKRGRKRKNVYRGIRRRPWGKWASEIRDPRKGTRVWLGTFNTAE
EAAMAYDVAAKRIRGDKAKLNFPDLIPPPLTSPPVSDDQPPAKKLCVLSQSELTQPSFPVECIGFGNGDQFQNRSYGFEL
DYDLKQQISSLESFLELDGGTTGEQPSQLDESVDVWMIDDVISSYA*

DNA
ATTTTATCAACATATACTGTACTCTCTATACATCATTTATCTTCGCCTATAAATGCGTTTCACGTCCACCAAACTCATCT
CTCTCTTGAAACCCAGCATAAGAGTGAAATAAAAGAAACAGAGAAAATGTGTGGCGGTGCTATCATATCCGATTTTGTTC
CTATCCTCACCAAGGCCAAGGGTAGGAAACTCACGGCGGAGGAACTCTGGTCTGAGCTCGATGCTTCCGCCGGCGACTAT
TTATGGAGTTTCCATCCCACCTCCAAGCTTCAACCCACCAACCAACAAGAAGTGGCGTTGAAAGATGAGGCGGTGGTGAA
GGAGAAGGAGAGGGAGCCAGCGACGACGGAGAAACGGGGGAGGAAGAGGAAGAACGTTTACAGAGGGATACGTAGGCGTC
CGTGGGGAAAATGGGCTTCAGAGATACGAGATCCACGGAAAGGCACCAGAGTCTGGCTCGGGACGTTCAACACGGCGGAG
GAAGCCGCCATGGCTTATGACGTAGCTGCTAAGCGTATCCGCGGCGATAAAGCCAAGCTCAACTTCCCTGATCTTATTCC
TCCTCCGCTGACATCACCCCCAGTGTCAGACGATCAGCCTCCGGCGAAGAAGCTCTGTGTACTCTCTCAGAGCGAGTTAA
CTCAGCCGAGTTTCCCGGTCGAGTGCATTGGGTTCGGGAACGGTGACCAGTTTCAGAACCGGAGTTACGGGTTTGAGCTT
GATTACGATCTTAAACAGCAGATATCGAGCTTGGAGTCTTTCCTTGAGCTTGACGGTGGTACCACGGGGGAGCAGCCGAG
TCAGCTCGACGAGTCAGTGGATGTGTGGATGATTGATGATGTCATCTCATCGTATGCATAA