Details for Kale Locus Bo5g123700

Position : C5 ( 5`- 38123861 .. 38126154 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123700

Protein [Map View]
MKCGKGKVWLDPSESKDISMANSRSLEKERSLKERVWAVRIEQGGSQDSSPENTTRFRVFDLLRSIQWAVLSVLTEYFCM
LMPPFAMQKFSRVFKDSRVWVFQRHSGYGKKKGTREVRQPTKVLWMNRLRVLRRFLLNYREKNKIDKHMYHDMYKKVKGG
VFKNKRVLMESIHKSKVEQAREKTLSGQFEAKRVKNKARKERKFARKKERLARGAGGGEIAVVS*

DNA
ATGAAGTGCGGGAAAGGAAAAGTGTGGCTTGATCCCAGTGAATCTAAGGATATCTCCATGGCTAATTCCAGGAGTCTAGA
GAAAGAACGCAGTCTTAAAGAGAGAGTTTGGGCGGTGAGGATCGAGCAAGGAGGATCGCAAGATTCTTCGCCGGAAAACA
CAACTAGGTTCAGAGTCTTCGATCTTTTAAGATCAATCCAGTGGGCGGTATTGAGCGTCCTCACTGAGTACTTTTGTATG
CTCATGCCTCCTTTTGCGATGCAGAAATTTTCACGTGTTTTCAAAGATTCACGGGTTTGGGTGTTTCAACGTCACTCTGG
TTATGGTAAGAAAAAGGGTACAAGAGAGGTGAGGCAACCCACCAAGGTTCTCTGGATGAATAGACTGAGGGTGTTGAGGC
GTTTCCTTCTCAACTACCGTGAGAAAAACAAGATCGACAAGCACATGTACCATGACATGTACAAGAAAGTGAAGGGTGGC
GTGTTTAAGAACAAGCGCGTGCTTATGGAGAGCATCCACAAGTCCAAGGTTGAGCAGGCGAGAGAGAAGACACTCTCTGG
CCAGTTTGAGGCCAAGCGTGTTAAGAACAAGGCTAGGAAGGAGAGAAAGTTTGCCAGAAAGAAGGAACGTTTAGCTAGAG
GAGCCGGAGGTGGAGAGATAGCTGTTGTGTCTTAA