Details for Kale Locus Bo5g123680

Position : C5 ( 5`- 38104067 .. 38105553 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123680

Protein [Map View]
MVLLPAFLDGLARSVSMKKGKYLSEDEDGGKEIAKSMMKYSKKNSTFLGSSGFVSSETSKRFTSICTNRGEKGINQDRAI
VWEGFGSQEDITFCGMFDGHGPWGHKITKRVKKLFPASLLCQWQQTLASLSSSPECFSPFDLWKQPCMKTFSIIDLDLKI
HPSIDSYCSGCTALTAILQGDHLVVANAGDSRAVIATTSDDGVGLVPVQLSVDFKPNIPEEAERIKQSDGRLFCLDDEPG
VYRVGMPNGRSLGLAVSRAFGDYCLKDFGLVSEPEVTYRKITSKDQFLILATDGMWDVMTNDEAVEIARGVKDRRKSAER
LVKKAMMLWRKKRRSIAMDDISALCLFFHPC*

DNA
ATGGTGCTTTTGCCTGCATTTTTGGACGGTTTGGCAAGAAGTGTATCGATGAAGAAAGGAAAATATCTATCTGAAGATGA
AGATGGAGGTAAAGAGATCGCAAAATCGATGATGAAATATTCCAAGAAGAACTCGACTTTCCTAGGTTCATCGGGCTTTG
TTAGCTCCGAAACTTCCAAGAGATTTACCTCTATTTGTACTAATAGAGGTGAGAAAGGAATAAACCAAGATCGTGCCATT
GTTTGGGAGGGTTTTGGAAGCCAAGAAGACATAACATTTTGTGGGATGTTCGATGGACATGGACCATGGGGACATAAGAT
AACCAAAAGAGTAAAAAAGTTATTTCCAGCTTCACTGCTTTGCCAGTGGCAACAAACTCTTGCATCCTTATCATCTTCAC
CGGAATGTTTCTCTCCGTTTGATCTTTGGAAGCAACCTTGCATGAAAACATTTTCTATCATCGATCTTGATCTCAAGATC
CATCCATCCATTGATTCTTACTGCAGTGGCTGCACCGCTCTCACCGCCATCTTGCAGGGTGATCATCTTGTTGTAGCAAA
TGCGGGTGACTCAAGAGCAGTAATAGCAACAACTTCTGATGATGGAGTCGGTTTAGTGCCGGTTCAGCTATCAGTAGACT
TTAAACCGAACATTCCCGAGGAAGCAGAACGGATAAAACAATCGGATGGACGGTTGTTTTGCCTAGATGATGAACCGGGA
GTGTACCGGGTGGGCATGCCAAATGGCAGATCGCTTGGTTTAGCTGTCTCAAGAGCGTTTGGAGATTACTGCCTTAAAGA
CTTTGGTTTAGTCTCTGAACCGGAAGTGACATACAGAAAGATAACCAGCAAGGACCAGTTTCTCATCTTGGCAACCGATG
GGATGTGGGATGTGATGACAAATGATGAAGCAGTGGAGATAGCAAGAGGAGTGAAAGACAGAAGAAAGAGCGCAGAGAGA
TTGGTAAAGAAAGCTATGATGCTTTGGCGTAAGAAGAGAAGAAGCATAGCCATGGATGATATATCTGCTCTCTGTCTCTT
CTTTCACCCTTGTTAA