Details for Kale Locus Bo5g123660

Position : C5 ( 5`- 38095648 .. 38099269 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123660

Protein [Map View]
MSSKGLKSTKRKDNESSEKPDALKSKKPKLSPSNPTDKKHNPTIQNQKPVGGQHGKPKAFGNNDKSVTLSKKERRVQAKE
LTEARKKRRKPHYTLEQELATLWEKMRRRDIGKEDRLKLISEALQKMKGKMHEIAGSHVSSRVLQTCLKYCSQDEKEVVF
KELHPHFLSLASNTYAVHVLQKMLDGASKQQLSSCISSLRGHVASLLRHMVGSVVVDHAYHLGNAAQKQELLGELYSTEL
QLFKDLNSTSEKRVVDIIAKLGLQKGSVIRHMTAIVQPILEKGIVDHNITHKLLIEYMTVADKTSAAFVIQQLSGPLLIR
MVHTRDGSRLAMLCVKHGSAKERKKLIKAMKTEKESHVGSIASDQYGSMVLACIFSIVDDTKLVTKIIVRELEANLKDLV
MGKNGRRPLLQLLHPNSSRYFSRDDLASLDLSVPSLCLMDKSETLSETKDSDGKESAEEEKDEQEDTVTEQSGLEENVTI
AGSKKDPLLRRQELLVKSGLAERLIDVCVENAEEFLKSNFAKEVMYEVAVGGCDGILLPTLSENLRELYQAIASVAAEPK
PEESEKSSQHILEDFHSSRTIRRLVLDSPTFASILFKKALSGKCRSWAQGHCSRILSAFLETQDVQVREMAKEELQVLGD
EGALKITGTKKPE*

DNA
ATGTCTTCCAAGGGACTGAAATCGACCAAGAGGAAAGATAACGAAAGCTCTGAGAAACCCGATGCTCTCAAATCGAAGAA
GCCGAAGCTGTCTCCCTCTAATCCCACCGACAAGAAACACAACCCTACGATTCAGAACCAAAAGCCTGTAGGAGGACAAC
ATGGTAAACCGAAAGCTTTTGGAAACAACGACAAGAGTGTTACCCTCTCCAAGAAGGAGCGTCGCGTACAAGCTAAGGAG
CTGACAGAAGCAAGGAAGAAGAGGAGGAAGCCTCATTACACTCTCGAGCAAGAGCTTGCTACCCTGTGGGAGAAGATGAG
GCGCCGTGATATTGGCAAGGAGGACCGTTTAAAGCTGATATCTGAAGCTTTACAGAAGATGAAGGGGAAAATGCACGAGA
TTGCAGGTTCTCATGTCTCTTCCCGTGTTCTCCAGACTTGTTTGAAGTATTGCTCGCAAGATGAGAAGGAAGTTGTTTTC
AAAGAGCTTCATCCGCATTTTCTTAGCCTGGCTTCTAACACATACGCTGTTCATGTGTTGCAGAAGATGTTGGATGGAGC
ATCTAAGCAGCAGCTGTCATCCTGTATATCCAGCCTCCGCGGACACGTGGCCTCTCTCCTCCGTCACATGGTCGGATCTG
TTGTTGTGGATCATGCATACCATCTGGGGAATGCAGCACAGAAACAAGAACTCCTTGGAGAGTTATACTCTACAGAGCTT
CAGTTATTCAAAGACTTGAACTCAACTTCCGAGAAAAGGGTGGTGGACATTATCGCAAAGCTAGGACTACAGAAAGGGTC
TGTTATCCGCCACATGACTGCCATTGTCCAACCAATTCTTGAGAAAGGAATTGTCGACCACAACATCACACACAAGTTGC
TGATTGAGTACATGACAGTAGCTGATAAGACTTCTGCTGCATTTGTGATTCAGCAACTGTCAGGCCCGCTTCTTATACGT
ATGGTTCACACCCGTGATGGTTCTAGGCTTGCTATGCTTTGTGTCAAACATGGAAGTGCTAAGGAGAGAAAGAAGCTTAT
CAAAGCAATGAAAACCGAGAAAGAAAGCCATGTTGGAAGTATTGCTTCTGATCAGTATGGAAGTATGGTGCTTGCATGTA
TTTTCTCCATAGTTGATGACACAAAGCTAGTAACCAAGATTATTGTTCGTGAGCTGGAGGCCAACTTAAAGGATCTTGTT
ATGGGAAAGAATGGTAGGAGACCACTATTGCAGTTACTTCATCCAAATTCTTCACGTTATTTCAGTCGTGATGATTTGGC
CTCTCTTGATCTGTCTGTTCCATCACTGTGCTTAATGGATAAGTCTGAGACATTGTCTGAGACAAAGGACTCAGATGGCA
AAGAATCTGCTGAGGAGGAGAAAGACGAGCAAGAAGATACTGTAACTGAACAGAGCGGTCTTGAAGAAAATGTCACAATT
GCTGGCAGTAAAAAAGATCCCCTTTTGAGAAGGCAGGAGTTGCTAGTCAAGAGTGGCCTTGCTGAGCGGCTTATTGATGT
CTGTGTGGAGAACGCTGAGGAATTCCTGAAGTCTAACTTTGCCAAAGAAGTCATGTATGAGGTGGCCGTGGGAGGGTGTG
ATGGTATTCTTTTGCCAACTTTGAGCGAGAATCTGCGTGAGCTGTACCAAGCCATTGCCTCTGTAGCAGCAGAGCCGAAA
CCCGAAGAATCAGAAAAGAGTTCACAACACATCCTGGAAGACTTTCACTCAAGCCGAACAATTAGAAGGCTGGTCTTGGA
CAGCCCTACTTTTGCTTCCATTCTTTTTAAAAAGGCCTTGTCTGGAAAGTGTCGGTCATGGGCTCAAGGACACTGTTCAA
GGATATTATCTGCTTTCTTAGAGACTCAAGATGTTCAAGTGCGTGAGATGGCTAAGGAAGAGCTGCAAGTGTTGGGGGAC
GAAGGGGCTCTAAAGATCACAGGAACCAAGAAACCCGAATGA