Details for Kale Locus Bo5g123640

Position : C5 ( 5`- 38075052 .. 38080379 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123640

Protein [Map View]
MSSLSRELVFLILQFLDEEKFKESVHKLEQESGFYFNIKYFEEKALAGEWDEVEKYLSGFTKVDDNRYSMKIFFEIRKQK
YLEALDRNDRAKAVEILAKDLKVFATFNEELYKEITQLLTLENFRENEQLSKYGDTKSARNIMYTELKKLIEANPLFREK
LAFPSFKASRLRTLINQSLNWQHQLCKNPRPNPDIKTLFLDHSCNAANGGARALTPVNLPVAAVARPSNFVPLGVHGGPF
QSTPAPAPNPNALAGWMANPNPASSVPSGVVASASPFPMQQPNQVNALKHPRPPSNSLGLMDYQNAADHDQLMRRLRSAQ
NEVTYPSHSHPPSASLDDLPRNVVSTMRQGSVVMSMDFHPAHHTLLAVGGSSGEISLWEVGSREKIVTEPFKIWNMSACS
GVLQGTIVKEPSISVTRVAWSPDGNFIGVSFNKHLIHVYAYQGSDLRQHLEIEAHVGRVNDLAFAHPNKQICIVTCGDDK
LIKVWDINGKKLYTFEGHEASVYSICPHQKENIQFIFSTALDGKIKAWLYDNVGSRVDYDAPGQWCTTMLYSADGSRLFS
CGTSKDGDSFLVEWNESEGALKRTYLGFRKKSKGVVQFDTTRNRFLAVGEDNQIKFWDMDNTNMLTTAEAEGGLPSLPRL
RFNKEGNLLAVSTADNGFKILANADGLRTLRAYEARSHEASKATIEMKVSTSAMVSALSPVVGKIEHMDTSSPARPTPIP
NGIEAMSRSIEKPRNLESVVDKSKTLELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGANGVQRLWKWSR
NEQNPTGKATASVTPQHWQPNSGLLMANDVSENPEAAVPCIALSKNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPPAST
FLAFHPQDNNIIAIGMEDSSIHIYNVRVDEVKTKLKGHQKHITGLAFSTALNTLVSSGADAQLFFWTADTWEKKKSSAIS
LPPGKAPVGDTRVQFHNDQIHLLVSHETQLAIYHATKMECIHKWVPQEALSSPITSASYSCNSQLVYASFADGNIAVFDA
DSLRLRCRIAPSAYMPQPTPNSAPIIPQVITTHPQEPNQLAVGLSDGSVKVIEPSEASRRWGVGVAVNADKAGTENGRPS
SSSAANNSSSDHQMQR*

DNA
ATGTCGTCTCTGAGCAGAGAGTTAGTTTTCTTAATCCTCCAGTTCTTAGATGAAGAGAAGTTCAAGGAATCTGTTCACAA
GCTAGAGCAGGAATCTGGGTTCTACTTTAATATAAAGTACTTTGAAGAGAAAGCTTTAGCTGGTGAGTGGGACGAAGTGG
AGAAGTATCTCTCAGGGTTTACCAAAGTTGATGATAATCGTTACTCTATGAAGATTTTCTTTGAGATCAGGAAGCAAAAG
TATCTCGAAGCTCTAGATCGTAATGACAGAGCAAAAGCTGTTGAGATATTAGCCAAAGACTTGAAAGTCTTTGCTACCTT
TAACGAGGAGCTTTACAAGGAGATCACTCAGCTTCTCACTCTTGAGAATTTCAGGGAGAACGAGCAATTGTCGAAGTATG
GTGATACAAAGTCAGCGAGGAATATAATGTACACTGAGCTGAAGAAGCTCATCGAGGCGAATCCTCTGTTTAGAGAGAAG
CTAGCCTTCCCTAGCTTCAAGGCTTCTCGCCTGAGAACTTTGATTAATCAAAGCTTGAATTGGCAGCACCAGCTATGTAA
AAACCCGAGGCCTAATCCTGACATCAAGACATTGTTCTTGGATCACTCTTGCAATGCAGCAAACGGTGGTGCTCGTGCAC
TCACTCCTGTGAATCTTCCTGTTGCTGCTGTTGCTAGACCTTCTAACTTTGTTCCTCTTGGTGTACATGGTGGACCTTTT
CAATCTACTCCTGCTCCAGCTCCTAATCCCAATGCTCTAGCTGGGTGGATGGCTAACCCAAATCCTGCCTCATCAGTTCC
ATCTGGTGTCGTGGCTTCTGCTTCTCCTTTTCCTATGCAGCAGCCAAATCAAGTTAATGCTCTGAAACATCCTAGACCAC
CGTCAAACTCTCTAGGATTGATGGATTATCAGAATGCTGCTGATCACGACCAGCTCATGAGACGTTTACGGTCTGCACAA
AATGAGGTCACATATCCTTCACATTCTCATCCTCCCTCTGCGTCACTTGATGACCTCCCTAGAAATGTGGTGAGTACAAT
GCGCCAAGGGTCGGTGGTGATGAGCATGGATTTTCACCCTGCGCATCACACTTTGCTCGCTGTTGGCGGTTCAAGCGGCG
AAATCAGCTTGTGGGAAGTTGGATCCAGAGAGAAGATCGTCACAGAGCCTTTTAAGATATGGAATATGTCAGCCTGTTCT
GGTGTCCTCCAGGGTACTATTGTCAAAGAACCATCAATATCCGTCACTCGTGTAGCATGGAGCCCAGATGGCAATTTTAT
TGGGGTTTCATTTAATAAACATCTGATTCATGTATATGCGTACCAAGGCTCAGACCTACGCCAACACCTTGAGATTGAAG
CTCATGTAGGACGTGTGAATGACTTGGCGTTCGCCCACCCAAACAAGCAAATATGTATTGTGACTTGTGGGGATGACAAA
TTGATCAAGGTGTGGGATATAAACGGGAAGAAGCTTTACACCTTTGAAGGCCACGAGGCATCGGTTTATTCCATTTGCCC
TCACCAGAAGGAAAATATTCAGTTTATATTCTCAACTGCCCTAGATGGTAAAATCAAGGCTTGGCTCTATGATAATGTTG
GTTCTAGGGTTGATTACGACGCACCAGGACAGTGGTGTACAACGATGTTATACAGTGCTGATGGAAGCAGGTTATTTTCT
TGTGGAACGAGTAAAGATGGAGACTCTTTCCTTGTTGAGTGGAATGAAAGCGAAGGTGCCCTGAAGAGGACATATCTAGG
CTTTAGGAAGAAATCTAAGGGAGTTGTTCAGTTTGATACAACTCGTAATCGTTTCTTGGCTGTTGGTGAAGACAATCAAA
TCAAATTCTGGGACATGGATAATACTAATATGTTGACTACTGCTGAAGCTGAAGGAGGCCTTCCGAGTCTTCCACGTTTG
AGGTTCAACAAGGAAGGAAACCTTCTTGCGGTTAGTACAGCGGATAACGGATTCAAGATCCTTGCAAATGCTGATGGGCT
TAGAACCTTGAGAGCATATGAAGCTCGTTCTCATGAAGCATCTAAAGCTACCATTGAGATGAAGGTATCAACTTCCGCAA
TGGTTTCAGCCCTGAGCCCAGTTGTTGGTAAAATTGAACACATGGACACAAGCTCTCCTGCAAGGCCCACACCAATTCCT
AATGGTATAGAGGCAATGTCAAGAAGTATAGAAAAGCCAAGAAACTTGGAATCTGTTGTTGATAAGTCTAAAACCTTGGA
GCTAACAGAAATTGTTGACCCCACTCAGTGCAGACAAGTGACAATGCCAGATAGCAAGGATTCTGTCAGCAAGGTTGCTC
GGCTTCTTTATACAAATTCCGGTGTTGGCGTATTGGCTCTGGGAGCAAATGGTGTTCAAAGACTATGGAAGTGGAGCCGC
AATGAGCAGAATCCAACTGGGAAGGCAACCGCTAGTGTAACTCCACAGCATTGGCAGCCTAACAGCGGTCTCCTAATGGC
AAACGATGTCTCTGAGAATCCTGAAGCAGCTGTGCCGTGTATAGCGCTTTCTAAGAATGACTCTTACGTGATGTCAGCTT
GTGGTGGAAAGGTTTCCTTGTTCAATATGATGACTTTCAAAGTGATGACAACCTTCATGCCACCACCACCAGCTTCAACC
TTTTTGGCGTTTCATCCTCAAGATAATAACATTATTGCAATCGGAATGGAAGACTCTAGTATCCATATCTACAACGTGAG
GGTTGATGAGGTGAAAACAAAGCTGAAAGGTCACCAGAAGCACATAACCGGTCTAGCATTCTCTACCGCACTCAATACCC
TCGTCTCTTCTGGTGCTGATGCTCAGCTCTTCTTTTGGACCGCTGACACATGGGAGAAGAAGAAATCTTCAGCGATTTCA
CTACCACCTGGAAAAGCACCGGTGGGTGACACACGTGTCCAGTTCCACAACGACCAAATCCATCTGTTGGTTTCACATGA
GACGCAGCTTGCTATTTACCATGCTACAAAGATGGAATGTATACATAAGTGGGTGCCACAAGAAGCTCTCTCTTCGCCCA
TAACCTCTGCATCTTACTCGTGCAACAGCCAGCTGGTTTACGCATCATTCGCTGATGGAAACATTGCTGTCTTTGATGCT
GATTCCTTGAGACTCAGATGTCGCATTGCTCCTTCTGCTTACATGCCCCAACCAACACCCAACAGTGCACCGATCATTCC
ACAAGTGATCACGACACATCCACAAGAACCGAACCAGTTAGCAGTTGGACTCTCTGATGGTTCAGTTAAAGTGATTGAGC
CATCTGAAGCTTCGAGAAGATGGGGCGTGGGGGTTGCAGTTAATGCAGATAAAGCAGGGACAGAGAATGGACGGCCATCG
AGCTCATCAGCAGCTAATAACTCAAGTTCAGATCATCAGATGCAAAGGTAA