Details for Kale Locus Bo5g123620

Position : C5 ( 5`- 38044327 .. 38047713 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123620

Protein [Map View]
MMNPSQGRGLGSGGGSSSGRNKGGEAVVEMFPSGLRVLVVDDDPTCLMILERMLRTCLYEVTKCNRAEMALSLLRKNKHG
FDIVISDVHMPDMDGFKLLEHVGLEMDLPVIMMSADDSKSVVLKGVTHGAVDYLIKPVRMEALKNIWQHVVRKRRSEWSV
PEHSGSIEETGQQQQQRGPAVSEDAADDNASSVNNEGNNWRSSSNNSRKRKEEEGDEQGDEDASNLKKPRVVWSVELHQQ
FVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQKYRIYLRRLGGVSQHQGNLNNSFMTGQDASFGPLSSLNGFDLQ
ALAVTGQLPAQSLAQLQAAGLGRPAMVSKSGLPVSSVVDERSIFSFDNSKPRFGDGIGGLQTQQPQMNLLHGVPTGMEPR
QLAGLQQQLPVGGNRMSIQQQIAAVRAGHSGMLMPQQQPFPRGPPSIRQPMLPNRITERSGFSGRSSVAESSRVLPTSYT
NLATQQHSSTSVAFNSFQQELPVNSFPLPSAPGLSVPTQVRKPHSSSSSYQEEVNSSEAGFATPSYDMFSNRHNDWDLRS
IAFDAHQDAESVAFSNSEAYSSSSMSRNNNNATVAATDLGRNQQLTQPIMVPHHQVYSNGGGGGSSVRVKSERDTAAMAF
HEQYSNQEDLMSALLKQEGVAPVVDTEFDFDAYSIDDIPV*

DNA
ATGATGAATCCGAGTCAGGGAAGAGGACTCGGATCGGGTGGTGGGTCGAGCTCCGGTAGAAACAAAGGAGGTGAAGCCGT
GGTGGAGATGTTTCCGTCGGGACTTAGAGTACTAGTGGTTGACGATGACCCGACTTGTCTCATGATCTTGGAGAGGATGC
TCAGAACTTGTCTCTACGAAGTAACGAAGTGCAACAGAGCAGAGATGGCATTGTCTCTGCTCAGAAAGAACAAACACGGA
TTCGATATTGTCATCAGCGATGTTCATATGCCTGACATGGACGGCTTCAAGCTTCTTGAACATGTTGGTCTTGAGATGGA
CTTACCTGTTATCATGATGTCTGCGGATGATTCAAAGAGTGTGGTTCTAAAAGGAGTCACTCACGGTGCGGTTGATTACC
TCATCAAACCGGTGCGTATGGAGGCGCTCAAGAACATATGGCAGCACGTGGTTCGTAAGAGGAGGAGCGAGTGGAGCGTG
CCTGAGCATTCTGGGAGCATTGAGGAGACCGGACAGCAGCAGCAACAGAGAGGTCCAGCTGTTTCTGAGGATGCGGCAGA
TGATAACGCTTCCTCTGTTAACAACGAAGGGAACAACTGGAGGAGCAGCAGCAATAACTCGCGGAAACGGAAAGAAGAGG
AAGGGGATGAGCAAGGGGACGAAGATGCCTCCAATCTGAAGAAACCGCGTGTTGTCTGGTCTGTTGAGTTGCATCAGCAG
TTTGTTGCTGCTGTTAATCAGCTCGGCGTTGAAAAGGCGGTTCCAAAGAAGATCTTAGAGCTGATGAATGTTCCTGGTCT
AACCCGTGAGAATGTAGCCAGTCACCTCCAGAAATACAGGATATATCTAAGACGCCTCGGGGGAGTCTCACAGCACCAAG
GAAACTTAAACAACTCGTTTATGACGGGTCAGGACGCGAGCTTTGGACCTCTTTCTTCACTGAACGGGTTCGATCTTCAA
GCGTTAGCAGTCACAGGCCAGCTCCCTGCTCAGAGCCTTGCGCAGCTTCAAGCCGCTGGTTTAGGCCGGCCTGCGATGGT
CTCCAAGTCGGGGCTGCCTGTTTCCTCGGTGGTGGACGAGAGAAGCATCTTCAGCTTCGACAACTCGAAACCAAGATTCG
GAGATGGGATTGGCGGTCTTCAAACACAACAACCGCAGATGAACTTGCTTCACGGTGTCCCCACGGGTATGGAACCGAGA
CAGCTCGCGGGGTTGCAACAGCAGCTTCCTGTTGGTGGTAATAGAATGAGCATTCAGCAACAGATTGCTGCTGTTCGAGC
CGGACATAGCGGAATGCTGATGCCTCAGCAGCAGCCATTCCCGCGAGGGCCACCCTCCATCAGGCAGCCTATGTTACCAA
ACCGTATAACTGAGAGAAGCGGCTTCTCGGGAAGGAGCAGTGTCGCCGAGAGCAGCCGTGTGTTACCTACAAGCTACACC
AACCTCGCAACGCAACAGCACTCATCAACTTCTGTAGCCTTCAACAGCTTCCAACAAGAGCTCCCCGTGAACAGCTTCCC
GCTTCCGAGTGCACCAGGCTTATCAGTTCCGACTCAGGTTCGGAAACCACATTCTTCCTCTTCTTCTTACCAAGAAGAGG
TTAACAGCTCGGAAGCGGGCTTCGCCACCCCAAGCTACGACATGTTCTCCAACAGACATAACGATTGGGATCTGCGGAGT
ATCGCTTTCGACGCGCATCAAGACGCGGAATCCGTAGCCTTCTCCAACTCAGAAGCCTACTCTTCTTCCTCCATGTCGAG
AAACAACAACAACGCAACGGTTGCAGCCACCGATCTTGGCCGGAACCAGCAGCTAACACAGCCAATCATGGTACCGCATC
ATCAGGTTTATAGCAACGGAGGCGGTGGTGGCAGTTCAGTGAGGGTGAAGTCGGAGAGAGATACAGCAGCGATGGCGTTC
CACGAGCAGTATAGTAATCAAGAAGATCTTATGAGTGCACTTCTTAAGCAGGAAGGAGTGGCACCGGTTGTTGATACCGA
GTTCGACTTTGACGCATATTCAATCGATGATATCCCGGTTTGA