Details for Kale Locus Bo5g123610

Position : C5 ( 5`- 38043343 .. 38043925 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123610

Protein [Map View]
MSEGSEETKTKLDSAGESSDVDNENCISSGSGGGSSGETKRTCVDCGTFRTPLWRGGPAGPKSLCNACGIKSRKKTQAAL
GIKPEKKIRNSIITSDSSDLSLEDDDDHKTCSSKGMSRFLDLGFKVPVMKRSSVEKKKRLWSKLGEEERAALLLMALSCA
SVYA*

DNA
ATGTCCGAGGGATCAGAAGAAACGAAAACAAAGCTTGATTCCGCCGGAGAGTCATCGGACGTCGATAACGAGAACTGCAT
TAGCAGTGGAAGTGGAGGTGGAAGTAGTGGCGAGACGAAGCGGACTTGCGTTGATTGCGGAACATTCCGAACTCCCCTTT
GGCGCGGTGGCCCCGCCGGACCTAAGTCGTTGTGCAATGCGTGTGGGATCAAGAGCAGGAAGAAGACGCAAGCTGCTCTC
GGAATCAAACCAGAGAAGAAAATCAGAAACAGTATCATTACCAGTGATTCCAGTGATCTAAGCCTGGAAGATGATGATGA
TCACAAAACTTGCAGCAGCAAAGGGATGAGTAGGTTTTTGGATTTAGGGTTTAAGGTTCCAGTGATGAAGAGATCATCGG
TCGAGAAGAAGAAGAGGCTGTGGAGTAAACTCGGCGAGGAAGAGAGAGCCGCCTTGCTTCTCATGGCTCTCTCTTGTGCC
TCCGTTTATGCTTAA