Details for Kale Locus Bo5g123580

Position : C5 ( 5`- 37992876 .. 37997219 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123580

Protein [Map View]
MDGDGSSGRLIGSEIHGFHTLQDLDVQTMLEEARSRWLRPNEIHAVLSNPKYFTINVKPVNLPTSGRIILFDRKMLRNFR
KDGHNWKKKKDGRTVKEAHEHLKVGDEERIHVYYAHGEDNTTFVRRCYWLLDKARENIVLVHYRDTQEAATTSGDSNSPS
AHSSSNLVAVEDIELNPNDSLFLAINNTPVVKTHETRLHDINTLDWDELLVQSDLDNQSAPIVDDMSYFTEHLQNATKDT
AEHLTVADESLDALLNNGPQSRENFGRWMDSFIGDPNGSLEDPSFEAMVTLYQDPLAPQATYNPHSDLPQQVFNITEVSP
AWAYSSEKTKIVVTGILHNSYQHLGSSNLFCICGDSCVPAEYVQAGVYRCFIPPHSPGMANLYLSADGHEPISQCFNFEH
RPAPVSAKPVHENNQESKWEEFELQVRLAHLLFTSSNKLNVLSSNISPENFLDAKKLSNKTSHLLNSWAYLIKSVQGSKV
SFDQAKDQIFELTLKNRVKEWLMEKVLEGRNARDYDSKGLGVIHLCAILGYTWSIQLFSLSGLSLDFRDKQGWTALHWAA
YYGREKMVAALLTAGAKPNLVTDSRKDNLGGCTPADLAQQNGFDGIAAYLAEKCLVAQFVAMKLAGNISGTLETCKGEMS
NQGPLPDDEQNLKDALAAYRTAAEAAARIQGAFREKALKTARSKVIQFDNKEEEAKSIIAAMKIQNAFRKYDTRRKIEAA
YRIQCRFQTWKMRKEFLNIRRQAIRIQAAFRGLQARKQYSKILWSVGVLEKAIIRWRQKRKLFVGLQVSEAEAEEKAEED
FYKASQKQAEERLERSVVRVQAMFRSKKAQEDYRRMKLTHEETQLEYEFLHDI*

DNA
ATGGATGGTGATGGTTCTTCCGGCAGGCTTATCGGCTCTGAGATTCATGGATTCCATACCTTACAAGATCTTGATGTACA
GACAATGTTGGAGGAAGCAAGAAGCAGGTGGCTCCGTCCTAACGAGATTCACGCTGTCCTCTCTAATCCTAAATACTTCA
CCATCAATGTCAAACCTGTCAACTTACCTACCAGTGGCAGAATCATACTGTTTGATCGTAAGATGTTGAGGAACTTCAGA
AAAGATGGTCATAACTGGAAAAAGAAAAAAGATGGAAGGACTGTTAAAGAAGCTCACGAACACCTCAAAGTCGGTGACGA
GGAAAGGATTCATGTATACTATGCACACGGTGAAGATAACACTACCTTTGTTCGTAGGTGTTATTGGTTACTAGATAAGG
CCCGAGAGAACATTGTCCTTGTACATTACCGTGACACACAAGAGGCAGCGACGACATCAGGGGACTCGAACTCTCCATCT
GCTCATTCATCTTCAAATCTTGTGGCAGTTGAAGATATCGAATTGAACCCTAATGACTCACTTTTTCTAGCAATCAACAA
CACTCCAGTTGTAAAAACTCATGAGACTAGGCTTCATGATATCAATACGCTTGATTGGGATGAGCTGCTTGTACAAAGTG
ATCTTGACAACCAATCCGCACCAATCGTTGATGATATGTCATACTTCACAGAACATCTCCAAAATGCCACAAAAGACACT
GCAGAGCATCTGACAGTGGCTGATGAATCTCTTGACGCTTTGCTTAACAATGGTCCTCAAAGCCGAGAGAATTTTGGTAG
GTGGATGGATTCCTTCATCGGCGACCCTAATGGTTCTTTGGAGGATCCGTCCTTTGAAGCCATGGTTACACTTTATCAGG
ATCCATTAGCTCCTCAAGCTACATATAATCCTCACTCCGACTTGCCTCAGCAAGTGTTCAACATAACTGAGGTTTCACCT
GCTTGGGCCTATTCTTCGGAGAAAACAAAGATTGTGGTAACTGGTATATTGCACAACAGTTATCAACATCTAGGAAGTTC
AAACCTTTTCTGCATCTGTGGAGACTCGTGTGTCCCTGCAGAGTATGTCCAGGCGGGAGTCTACCGTTGTTTCATACCTC
CTCACTCGCCTGGCATGGCAAACCTCTATCTTAGTGCAGATGGACACGAGCCAATAAGCCAGTGTTTCAACTTCGAACAC
CGCCCAGCCCCAGTTTCTGCCAAGCCCGTTCATGAAAACAATCAAGAATCCAAATGGGAAGAGTTTGAGCTCCAAGTCAG
ACTTGCTCATCTCCTATTTACCTCTTCCAACAAACTCAACGTTCTCTCCAGCAATATCTCACCTGAAAACTTTCTAGATG
CTAAAAAACTCTCCAACAAGACTTCTCATCTCTTGAACAGTTGGGCTTATCTGATCAAGTCCGTTCAGGGGAGTAAGGTG
TCTTTTGATCAAGCGAAAGACCAAATCTTCGAGCTTACTCTGAAGAACAGGGTTAAGGAATGGCTGATGGAGAAAGTGCT
TGAAGGTCGCAACGCACGGGACTATGACTCTAAAGGCCTCGGTGTGATCCACCTCTGTGCCATTCTTGGGTACACTTGGT
CTATCCAGCTCTTCTCGTTGTCAGGTTTATCGTTAGACTTCCGTGATAAACAAGGATGGACTGCTCTTCATTGGGCTGCG
TACTACGGAAGGGAGAAAATGGTGGCTGCTCTTCTCACTGCTGGGGCTAAACCAAACTTGGTTACAGACTCAAGAAAGGA
TAATCTTGGCGGATGCACTCCCGCTGATCTGGCACAGCAAAACGGGTTTGATGGTATAGCTGCTTACCTTGCTGAGAAAT
GTTTGGTAGCTCAGTTTGTAGCCATGAAGCTTGCTGGAAACATTAGTGGAACCCTGGAGACTTGCAAGGGGGAGATGTCA
AACCAAGGTCCTCTCCCAGATGATGAGCAGAATCTTAAGGACGCTTTGGCGGCATACAGAACAGCTGCAGAAGCAGCGGC
TAGGATTCAGGGAGCGTTTAGGGAGAAGGCTTTGAAGACAGCACGGTCAAAAGTGATCCAGTTTGACAACAAGGAAGAAG
AGGCTAAGAGCATAATCGCGGCGATGAAGATTCAGAACGCTTTCCGCAAGTACGATACGCGTAGGAAGATAGAAGCTGCT
TACAGGATCCAGTGTAGGTTCCAAACATGGAAAATGCGAAAAGAGTTCTTAAATATTAGGCGTCAAGCAATTAGGATCCA
GGCGGCATTCAGGGGGTTACAAGCAAGGAAGCAGTACAGCAAGATCTTATGGTCGGTAGGAGTGTTGGAGAAGGCAATAA
TCAGGTGGAGACAAAAGAGAAAATTGTTTGTAGGACTCCAAGTGAGCGAAGCTGAAGCAGAGGAAAAAGCAGAGGAAGAT
TTCTACAAGGCGAGTCAGAAACAAGCCGAGGAGAGGCTCGAGAGATCTGTGGTGCGGGTTCAAGCCATGTTCAGGTCTAA
GAAAGCTCAAGAGGATTACAGGAGGATGAAACTCACTCATGAAGAAACTCAGTTGGAGTATGAGTTCCTGCATGATATTT
GA