Details for Kale Locus Bo5g123530

Position : C5 ( 5`- 37944670 .. 37945876 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123530

Protein [Map View]
KHQLSLSGAILQRERERERERERIKLSLKKVVLVRRERERERMADSGGRRIGVAVDFSECSKKALNWAIDNVVRDGDYLI
LITVAPNMNYEEGEMQLWETVGSPLIPLSEVSEASVMKKYGVKPDAETLDIANTAATQKSITVVMKIYWGDPREKLCEAA
EHIPLSSIVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVKAHH*

DNA
AAACACCAGTTGTCTTTGAGTGGCGCTATTTTGCAGAGAGAGAGAGAGAGAGAGCGAGAGAGAGAAAGAATCAAGCTTTC
GTTGAAAAAAGTGGTACTCGTACGGAGAGAGAGAGAGAGAGAGAGGATGGCGGATAGTGGTGGACGGAGAATCGGAGTGG
CGGTGGACTTCTCGGAGTGCAGCAAGAAGGCTCTGAACTGGGCGATCGACAACGTGGTCCGCGACGGAGATTATCTAATC
CTCATAACCGTGGCTCCCAATATGAATTACGAGGAAGGCGAGATGCAGCTCTGGGAGACCGTTGGATCACCGTTGATTCC
ACTGAGTGAGGTCTCGGAAGCTTCCGTGATGAAGAAGTATGGAGTGAAGCCAGATGCTGAAACCCTTGACATTGCCAACA
CTGCCGCTACGCAAAAATCGATTACAGTAGTGATGAAGATATACTGGGGAGATCCTCGTGAGAAGTTATGTGAAGCTGCT
GAACATATCCCTCTCTCAAGTATTGTCATCGGTAATCGCGGCCTTGGTGGCCTTAAGAGGATGATAATGGGAAGCGTTAG
CAACCATGTCGTCAACAACGTTGCATGCCCTGTTACCGTCGTCAAGGCTCACCACTGA