Details for Kale Locus Bo5g123490

Position : C5 ( 5`- 37923189 .. 37924655 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123490

Protein [Map View]
MDCRTTMILVLTLILMSVWGSDASAMQTTKFDAPLLTEKIATNRSIIVDIEGKGDYTSVQKAIDAVPVGNSNWIIVHVRK
GIYKERVHIPENKPFIFMRGNGRGKTVIESSQSSVDNVASATFKVEANHFVAFGITIRNDAPVGMAFTSDNQSVAAFVAA
DKVAFYHCAFFSLHNTLFDNKGRHYYHQCYIQGSIDFIFGRATSIFNNCEIFVISDKRVKPYGSITAHHRENAEENTGYV
FIRGKVYGIDEVYLGRAKGPYSRVIFAKTYFSKTVVPDGWTNWSYDGSTKDLYHAEYKCHGPGADRQRRSSWAKELTKQE
VESFLSIDFIDGTAWLPVWLQQKS*

DNA
ATGGATTGTAGAACAACAATGATACTTGTCCTAACCCTGATTTTAATGTCCGTATGGGGTTCAGACGCATCCGCAATGCA
AACGACAAAGTTCGACGCACCGCTTCTGACTGAAAAAATCGCAACAAACAGATCGATAATTGTCGATATTGAAGGCAAAG
GAGACTACACTTCGGTTCAAAAAGCCATTGATGCTGTCCCTGTTGGTAACTCTAATTGGATTATCGTCCATGTCCGTAAA
GGAATCTACAAGGAGAGAGTGCACATTCCGGAGAACAAGCCGTTCATATTTATGAGAGGTAACGGAAGAGGAAAGACGGT
CATCGAATCATCGCAAAGTTCGGTCGATAATGTTGCTTCAGCCACTTTCAAAGTCGAAGCTAACCACTTCGTTGCTTTTG
GTATCACCATCAGGAATGATGCACCGGTCGGAATGGCGTTCACGTCTGATAACCAATCCGTGGCAGCGTTTGTGGCTGCC
GACAAAGTTGCGTTTTATCATTGTGCGTTCTTCAGCTTGCACAACACTTTGTTTGATAACAAAGGTAGACATTATTACCA
TCAGTGTTACATCCAAGGCTCTATCGACTTCATCTTCGGTCGTGCAACTTCCATTTTCAATAACTGTGAGATATTTGTGA
TATCGGACAAGAGGGTGAAACCCTACGGGTCAATCACAGCACACCACAGGGAAAACGCAGAGGAAAATACTGGTTATGTT
TTCATAAGAGGCAAAGTGTACGGAATCGATGAGGTTTACTTGGGAAGGGCCAAAGGACCGTACTCTCGGGTCATCTTTGC
CAAGACTTACTTTTCCAAGACCGTTGTCCCTGACGGTTGGACAAACTGGAGCTACGACGGCTCAACCAAGGACTTATACC
ACGCAGAGTATAAGTGTCATGGACCAGGTGCTGATAGGCAACGTAGATCAAGTTGGGCCAAAGAACTTACCAAACAAGAA
GTTGAGTCTTTCTTGTCCATTGATTTCATTGATGGAACGGCATGGCTTCCTGTTTGGCTTCAGCAAAAGTCTTAG