Details for Kale Locus Bo5g123470

Position : C5 ( 5`- 37915080 .. 37918085 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123470

Protein [Map View]
MMKPKSIAAAFASWFVIISLLCSCISGDQNETNYEGLSYNYYEKTCPRLDEIVRSSISPMFALDPTAPAALLRLMFHDCQ
VQGCDASILIEPSGDQQFTELDSAKNFGIRKRELIGSIKTSLEVECPQQVSCSDLIILVAREAVALTGGPLIAVPLGRKD
SLSTPSKHVADSELPPSTADVDSILNLFAGIDMTIEESVAIMGSHSIGVTHCNNVLSRFDNENATNANMDPRFQTFLRVV
CPEFSPTSKTAEATFVPNDQTSLIFDTAYYDDSIAGRGNLRIDSEIGVDPRTRPFVEAFAADQDRFFGSFSSAFVKLSSY
KVLTGNNGVVRGVCDKVD*

DNA
ATGATGAAACCAAAGAGCATAGCTGCAGCTTTTGCATCATGGTTTGTAATCATAAGCTTGTTATGCAGCTGCATTAGTGG
CGACCAAAATGAGACCAATTATGAAGGTCTATCTTACAATTACTACGAGAAAACATGTCCAAGACTCGATGAGATCGTGA
GATCTTCAATTTCACCAATGTTTGCTCTTGATCCTACGGCTCCGGCCGCCTTGCTAAGGCTTATGTTTCATGACTGTCAA
GTTCAGGGATGTGACGCATCTATCCTAATCGAGCCAAGTGGGGACCAGCAGTTCACAGAGCTTGACTCAGCCAAGAACTT
CGGAATCAGAAAGAGGGAACTCATTGGCTCAATCAAAACCTCATTGGAGGTCGAATGTCCCCAGCAAGTCTCTTGCTCTG
ACCTCATCATCCTCGTCGCTAGAGAAGCCGTCGCTCTCACTGGTGGCCCACTCATCGCAGTGCCGTTAGGAAGAAAAGAC
TCTCTCTCCACTCCCAGCAAACACGTGGCTGACTCTGAGCTTCCTCCCTCCACTGCTGATGTCGACTCTATCTTAAATCT
CTTTGCTGGCATAGACATGACCATCGAGGAGTCCGTAGCCATTATGGGTTCACATTCAATAGGAGTGACACACTGTAACA
ACGTGTTATCGCGTTTTGATAACGAAAACGCAACGAACGCGAACATGGATCCACGTTTTCAAACATTTTTGCGAGTTGTT
TGCCCAGAGTTTTCTCCGACATCCAAAACAGCGGAAGCTACATTTGTTCCCAACGACCAGACTTCGTTGATCTTTGACAC
AGCTTATTATGATGATTCCATCGCGGGACGTGGCAACCTGAGAATTGACTCGGAGATTGGAGTGGACCCACGCACACGCC
CGTTTGTCGAAGCGTTTGCGGCTGATCAGGACCGTTTCTTCGGTTCCTTCTCTTCCGCGTTTGTTAAATTGTCTTCTTAC
AAAGTGTTAACCGGGAATAATGGAGTAGTTAGAGGCGTGTGTGACAAGGTAGATTGA