Details for Kale Locus Bo5g123450

Position : C5 ( 5`- 37896192 .. 37897045 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123450

Protein [Map View]
MDSISPLSNQTTTTSSGSDLSRRKCKKKSPSSPPPSLEKWRSEKQQQIYSTNLGHALRELRISQPSPNPNGRAVREVADR
ALAVAARGKTLWSRAILSKAVKLKFRKHKRQRIANPALTQPVIATGSLRSKKQRAATVMRIKAKGLPAVQRKVKVLSRLV
PGCRKQTLPVVLEETTDYIAAMEMQIRAMTALLSAVSSPTEHEEGQTHVLVS*

DNA
ATGGACTCCATCTCTCCGCTTTCCAATCAGACGACGACGACGAGCTCTGGCTCCGATCTCTCTCGCCGTAAGTGTAAGAA
GAAATCTCCGTCGTCTCCGCCTCCATCGTTAGAGAAATGGAGATCGGAGAAGCAGCAACAGATCTACTCCACGAACCTCG
GCCACGCTCTTCGCGAGCTTCGTATCAGCCAACCGTCACCCAATCCTAACGGCAGAGCCGTGCGCGAAGTCGCCGACAGA
GCGTTAGCCGTCGCGGCGAGAGGCAAAACGCTATGGAGCCGAGCGATACTGTCCAAGGCGGTCAAACTCAAGTTCAGGAA
ACACAAACGGCAGAGAATCGCGAACCCGGCGTTGACTCAGCCGGTAATCGCTACCGGGAGTCTCAGGTCGAAGAAACAGA
GAGCGGCGACGGTTATGAGGATTAAAGCTAAAGGATTGCCAGCTGTACAGAGGAAAGTTAAGGTTTTGAGCCGGTTAGTT
CCCGGTTGCCGTAAACAGACGTTACCGGTGGTTTTGGAAGAGACCACTGATTATATAGCTGCCATGGAGATGCAGATTCG
CGCCATGACTGCTCTTCTCTCCGCCGTCAGCTCTCCGACAGAACATGAAGAGGGACAAACACATGTGCTTGTTTCTTGA