Details for Kale Locus Bo5g123390

Position : C5 ( 5`- 37815951 .. 37816797 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123390

Protein [Map View]
MGMSLDFDVDLEKGILDCQNVYTKSPEKPSIPMCPDIKPVETGLLENDASPVKCAISKPEWGRSERKEKRKKSASKPPRP
PRGPSLDAADEKLIREIAELAMLKRARVERMRALKKSREAKAASASSSLGNVFATILTAIFFFVLVFQGLSPRAAASSGE
SPFVGKASGGFVPVQYAGNPSASEPGVGYGGPVIAQRMPNLLKPVSGLENEQKMNRVSQ*

DNA
ATGGGAATGAGTCTTGATTTCGATGTTGATCTTGAGAAAGGAATCTTAGATTGCCAAAATGTTTATACAAAATCGCCGGA
GAAGCCATCGATACCGATGTGTCCAGATATCAAACCGGTAGAAACCGGTTTGTTAGAGAACGATGCAAGTCCGGTTAAAT
GTGCGATCAGTAAACCGGAATGGGGGAGGAGTGAACGGAAGGAGAAACGCAAGAAATCAGCGTCGAAACCTCCTAGGCCG
CCGCGTGGACCATCGCTAGACGCAGCGGATGAGAAACTGATAAGGGAGATCGCTGAGCTGGCGATGCTGAAACGCGCGAG
GGTGGAACGTATGAGAGCTTTGAAGAAATCGAGAGAGGCCAAAGCTGCGTCTGCCTCCTCTTCTCTCGGCAATGTATTCG
CCACTATTCTCACCGCTATCTTCTTCTTCGTCCTTGTTTTCCAAGGATTGTCGCCGAGAGCAGCCGCTAGCTCCGGGGAA
TCTCCCTTTGTTGGAAAAGCCAGTGGTGGTTTTGTACCGGTTCAATATGCGGGAAACCCATCTGCGAGCGAACCGGGTGT
AGGTTATGGCGGTCCGGTTATAGCACAGAGAATGCCCAATTTACTAAAACCAGTTTCTGGATTAGAGAATGAACAGAAGA
TGAATAGAGTTTCACAGTGA