Details for Kale Locus Bo5g123380

Position : C5 ( 5`- 37812820 .. 37813371 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g123380

Protein [Map View]
MKRSSAVTSPPSLSLFLLLLLPLLAQSSDDLIDKICRVTPFIDLCEASLRPLTPSPSDPKSLASAMASVVLGNMTDTLGY
IQSLIRHSHDPAAERALAQCAELYRPVVKFNIPQAIDAMRRGELGFATYVLGDAEKQTDTCQKWINSAGADDENSVALTA
RNKQVKNLCDVAISVIKSLMKGR*

DNA
ATGAAAAGATCCTCCGCCGTCACGTCACCGCCATCTCTCTCCCTCTTTCTCCTCCTGCTCCTACCATTGCTAGCTCAATC
CTCCGACGACCTTATCGACAAAATCTGCAGAGTGACGCCGTTCATCGACCTCTGTGAAGCCTCTCTCCGCCCTCTCACTC
CCTCACCTTCCGACCCCAAGTCTCTAGCCTCGGCCATGGCTTCCGTTGTTCTTGGTAACATGACTGATACGTTAGGCTAT
ATCCAATCACTGATCAGACACTCTCACGATCCTGCGGCAGAGCGAGCACTAGCTCAGTGCGCTGAGCTGTACCGGCCGGT
GGTCAAGTTCAACATTCCTCAGGCGATCGACGCAATGCGGCGAGGAGAGTTAGGGTTCGCGACGTATGTGCTCGGAGACG
CTGAGAAACAGACTGACACTTGCCAGAAGTGGATCAACAGTGCCGGTGCTGATGATGAAAATTCGGTGGCTCTTACGGCT
AGAAACAAGCAGGTTAAGAATCTTTGTGACGTGGCCATTTCTGTGATTAAGTCTCTAATGAAGGGTCGTTAA